Recombinant Human herpesvirus 6B Protein U9 (U9)

Shipped with Ice Packs
In Stock

Description

Functional Context in HHV-6B

HHV-6B encodes approximately 119 open reading frames (ORFs) within its 162,114-bp genome, divided into a unique (U) segment and direct repeat (DR) regions . While U9 is not extensively studied in functional genomics compared to other HHV-6B genes (e.g., U94, U90), its recombinant form enables structural and immunological analyses.

Expression System

The U9 protein is expressed in E. coli, leveraging bacterial systems for high-yield production. The His-tag facilitates affinity chromatography purification, ensuring minimal contaminants.

Quality Control

  • Purity Validation: SDS-PAGE confirms >90% purity, with no significant degradation observed.

  • Stability: Lyophilized powder is stable at -20°C/-80°C. Repeated freeze-thaw cycles are discouraged.

  • Reconstitution: Recommended in sterile water or buffer with glycerol (5–50% final concentration) for long-term storage .

Immunological Studies

The recombinant U9 protein serves as an antigen in serological assays to detect HHV-6B-specific antibodies. While not a dominant immunogenic target compared to U11 (virion protein) or U100 (tegument protein) , it may contribute to understanding viral immune evasion mechanisms.

Viral Mechanism Studies

HHV-6B’s U region encodes core genes essential for replication and latency, including origin-binding proteins (U69 homolog) . While U9’s role remains uncharacterized, its recombinant form could be used to screen for interactions with viral or host proteins.

Functional Annotation Challenges

  • Sparse Functional Data: Unlike U94 (implicated in viral integration and replication) or U90 (immediate-early gene) , U9 lacks robust functional annotation.

  • Expression Patterns: No transcriptome or proteomic data explicitly confirm U9 expression during HHV-6B infection .

Clinical Relevance

No studies directly link U9 to HHV-6B pathogenesis, such as neurovirulence or immunosuppression. Its role in viral-host interactions remains speculative.

Sequence Conservation

HHV-6A and HHV-6B share ~90% nucleotide identity, with divergence concentrated in DR regions and the U segment’s right end (U86–U100) . U9’s sequence conservation across HHV-6B strains is not explicitly reported, though recombinant U9 is derived from a conserved full-length sequence .

Recombination and Diversity

HHV-6B exhibits geographic clustering (e.g., Japanese vs. New York strains) and recombination, particularly in U90 and U94–U100 regions . U9’s sequence stability in these contexts remains unexplored.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please notify us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
U9; Protein U9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-104
Protein Length
full length protein
Species
Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus)
Target Names
U9
Target Protein Sequence
MAVRKLWKTVVQLFSKSKSEECNTEAGTMEVSCLKYGVQGLNADCSYVKSQCIKLSECEC LYTFASDVCKEDFHNSEEMKVFVVQHSQEIVGGTDFSVHAEESV
Uniprot No.

Target Background

Database Links

KEGG: vg:1497009

Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What is the genomic context of the U9 gene within the HHV-6B genome?

The U9 gene is located within the unique segment (U) of the HHV-6B genome, which spans approximately 144,528 bp in the Z29 strain. The complete HHV-6B genome is approximately 162,114 bp, consisting of a unique segment flanked by 8,793-bp direct repeats (DR) . Based on genomic analyses, the HHV-6B genome contains 119 unique open reading frames (ORFs) that compose 97 unique genes, with U9 being one of the genes within the unique segment . Researchers investigating U9 should consider its position relative to other genes to understand potential regulatory relationships and expression patterns during infection cycles.

What expression systems are most suitable for producing recombinant HHV-6B U9 protein?

For optimal expression of recombinant HHV-6B U9 protein, researchers can use several systems:

  • Mammalian expression systems: 293T cells can be effectively transfected with expression plasmids using Lipofectamine 2000 or the calcium phosphate method as demonstrated for other HHV-6B proteins . These systems are particularly valuable when post-translational modifications are important for protein function.

  • Adenovirus vector systems: For higher expression yields, recombinant adenovirus vectors can be constructed using systems similar to those described for other HHV-6B proteins. This involves cloning the U9 gene into vectors like pHMCA5, followed by subcloning into adenovirus vectors such as pAdHM34 .

  • T-cell expression systems: Since HHV-6B naturally infects T cells, expression in cell lines such as SupT1 or MOLT3 may provide a more biologically relevant context for functional studies, as demonstrated for other viral proteins .

How can researchers validate the authenticity of recombinant U9 protein expression?

Authentication requires a multi-faceted approach:

  • Western blotting: Develop or acquire antibodies specific to U9 protein. If commercial antibodies are unavailable, expression with epitope tags (HA, FLAG) can facilitate detection using commercially available anti-tag antibodies .

  • Mass spectrometry: Shotgun proteomics approaches can confirm the identity of the expressed protein. This method has been successfully applied to other HHV-6B proteins, allowing for verification of predicted amino acid sequences .

  • RNA expression validation: RT-PCR can confirm transcript expression before protein purification, with Sanger sequencing of PCR products to confirm sequence identity .

Validation MethodAdvantagesLimitationsRequired Equipment
Western BlottingRelatively simple, widely accessibleRequires specific antibodiesGel electrophoresis system, transfer apparatus
Mass SpectrometryHighly specific, can identify modificationsExpensive, requires specialized equipmentMass spectrometer, HPLC system
RT-PCR + SequencingConfirms transcript before protein expressionDoesn't confirm protein productionThermal cycler, sequencing capability

How does RNA-seq data inform our understanding of U9 expression kinetics during HHV-6B infection?

RNA-seq analysis of HHV-6B gene expression can reveal the kinetic class and expression patterns of U9 during infection. Research methodologies should include:

  • Time-course experiments: Similar to studies of other HHV-6B genes, researchers should analyze U9 expression at multiple time points post-infection (e.g., 6, 9, 12, 24, 48, and 72 hours) to establish expression kinetics .

  • Inhibitor studies: Use of protein synthesis inhibitors like cycloheximide (CHX) can classify U9 as immediate-early (IE), early (E), or late (L) gene. Additionally, DNA replication inhibitors like phosphonoacetic acid (PAA) can further refine this classification .

  • Differential expression analysis: RPKM (Reads Per Kilobase Million) values should be calculated and compared across time points to quantify relative expression levels, as has been done for other viral genes in different cell types (SupT1 vs. MOLT3) .

  • Strand-specific sequencing: This approach can identify antisense transcripts or overlapping genes that might regulate U9 expression .

What structural and functional analyses are most informative for characterizing U9 protein?

To thoroughly characterize U9 protein structure and function:

  • Protein domain prediction: Computational analyses to identify functional domains, transmembrane regions, or signal sequences.

  • Mutagenesis studies: Systematic creation of deletion mutants and point mutations to map functional domains, similar to approaches used for other HHV-6B proteins like U14 .

  • Protein-protein interaction screens: Yeast two-hybrid, co-immunoprecipitation, or proximity labeling techniques to identify viral and cellular interaction partners. For example, studies of U14 revealed interaction with cellular protein EDD and subsequent effects on cell cycle .

  • Subcellular localization: Immunofluorescence microscopy with tagged recombinant U9 or specific antibodies can reveal localization patterns during infection, providing clues to function.

  • Functional assays: Based on predicted functions, develop specific assays to test hypotheses about U9's role in viral replication, immune evasion, or other processes.

How can researchers determine if U9 undergoes alternative splicing during viral infection?

Alternative splicing analysis requires:

  • RNA-seq analysis across infection time course: Deep sequencing can reveal novel splice junctions, as demonstrated for other HHV-6B genes .

  • RT-PCR validation: Design primers flanking predicted splice sites, followed by gel electrophoresis to visualize multiple transcript variants and sequencing to confirm splice junctions .

  • Long-read sequencing: Technologies like PacBio or Oxford Nanopore can capture full-length transcripts, providing comprehensive identification of splice variants.

  • Splice junction-specific antibodies: Generate antibodies that recognize epitopes created by specific splice junctions to confirm protein expression from alternatively spliced transcripts.

Evidence from HHV-6B transcriptome studies has identified numerous previously unknown splicing events, including complex splicing spanning large genomic regions (>13,000 bp) . Similar analyses focused specifically on U9 could reveal unexpected transcript complexity.

What cell culture systems are most appropriate for studying U9 protein function in the context of viral infection?

Selected cell systems should reflect research goals:

Cell SystemAdvantagesLimitationsApplications
MOLT3/SupT1Supports viral replication, established protocolsTransformed cellsViral replication studies, protein expression kinetics
CBMCsPhysiologically relevantDonor variability, limited lifespanPrimary infection studies, immune response evaluations
293T/HeLaHigh transfection efficiencyNot natural host cellsProtein overexpression, localization studies

What purification methods yield the highest purity and biological activity for recombinant U9 protein?

Effective purification strategies include:

  • Affinity chromatography: His-tag or GST-tag purification systems provide efficient single-step purification. For challenging proteins, consider dual-tagging strategies.

  • Size exclusion chromatography: As a secondary purification step to separate monomeric from aggregated forms and remove contaminants of different molecular weights.

  • Ion exchange chromatography: Based on the predicted isoelectric point of U9, select appropriate resins for further purification.

  • Testing for proper folding: Circular dichroism spectroscopy and thermal shift assays can confirm proper protein folding after purification.

  • Activity assays: Develop functional assays based on predicted activities to ensure purified protein retains biological activity.

How can CRISPR-Cas9 genome editing be used to study U9 function during viral infection?

CRISPR-Cas9 approaches for studying U9 include:

  • Viral genome editing: Direct modification of the U9 gene in bacterial artificial chromosomes (BACs) containing the complete HHV-6B genome allows for generation of mutant viruses.

  • Cellular factor knockout: Identification of U9 interaction partners through proteomics followed by CRISPR knockout of these factors in host cells can reveal their importance in U9 function.

  • Domain mapping: Introduction of small deletions or point mutations can precisely map functional domains within the U9 gene.

  • Complementation studies: Express wild-type U9 in cells infected with U9-mutant virus to confirm phenotype specificity.

  • Inducible systems: Combine CRISPR with inducible expression systems to control the timing of U9 disruption during infection.

How does U9 protein sequence and function compare between HHV-6A and HHV-6B?

Comparative analysis requires:

What bioinformatic approaches are most useful for predicting U9 protein function?

Comprehensive bioinformatic analyses should include:

  • Sequence homology searches: Beyond standard BLAST searches, use sensitive methods like PSI-BLAST or HHpred to identify distant homologs.

  • Structural prediction: AlphaFold2 or RoseTTAFold can predict protein structure even with limited homology to known structures.

  • Motif identification: Search for functional motifs that might suggest enzymatic activity, nucleic acid binding, or other functions.

  • Evolutionary analysis: Examine selection pressures across different viral isolates to identify conserved (functionally important) regions versus variable regions (possibly involved in immune evasion).

  • Co-evolution analysis: Identify other viral or cellular proteins that show correlated evolutionary patterns, suggesting functional relationships.

How might single-cell approaches advance our understanding of U9 expression and function?

Single-cell technologies offer new insights:

  • Single-cell RNA-seq: Can reveal heterogeneity in U9 expression across infected cells and identify correlations with cellular states or expression of other viral genes.

  • Single-cell proteomics: Emerging technologies allow protein-level analysis at single-cell resolution to correlate U9 expression with cellular outcomes.

  • Spatial transcriptomics: Can map U9 expression within infected tissues to understand its role in viral spread and pathogenesis.

  • Live-cell imaging: Using fluorescently tagged U9, researchers can track its localization and dynamics during infection in real-time.

What is the potential role of U9 in HHV-6B immune evasion strategies?

Investigation approaches should include:

  • Immune receptor binding assays: Similar to studies of U20 protein binding to ULBP1 , examine whether U9 interacts with immune receptors.

  • Effects on antigen presentation: Measure changes in MHC-I and MHC-II surface expression in the presence of U9 alone or during infection.

  • Cytokine profiling: Assess whether U9 expression alters cytokine production by infected or bystander cells.

  • Interaction with pattern recognition receptors: Test whether U9 modulates innate immune sensing pathways that detect viral infection.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.