Recombinant Human herpesvirus 6B Putative immediate early glycoprotein (U18)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your reconstitution.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
U18; Putative immediate early glycoprotein; Protein U18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-294
Protein Length
Full Length of Mature Protein
Species
Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus)
Target Names
U18
Target Protein Sequence
SNLTCEQKIVLIQEQKLGAICISTCYVNGVLAGNSSCVSVRTSYLINLAMLTDGFKAMKV GNITSISEKTAFLRVIINYYFRGVMLRALIAKRLPNAAQLSSTVNCWLEGHSAGGVMTLF YGTERIVLKSSTEMNASQWTSDGPDANGTLNILNERVSLDSYFLSMICPQLSDEIYKKKV VHSKYFSLIKNDTMPKKFLRNTWKSAWTNWYKYKEIEALLDFSRDYENVSEITHSMSAAG LFFLAGGAFTMLLLLCCLSMITRKHVVKDLGYK
Uniprot No.

Target Background

Database Links

KEGG: vg:1497014

Protein Families
Herpesviridae immediate early glycoprotein family
Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What is known about the structure and function of HHV-6B U18 glycoprotein?

HHV-6B U18 is classified as a putative immediate early glycoprotein, suggesting its expression occurs early in the viral replication cycle. While specific structural information about U18 is limited in current literature, research approaches used for other HHV-6B glycoproteins can inform U18 investigations. Similar to other viral glycoproteins, U18 likely undergoes post-translational modifications, particularly N-linked glycosylation. As observed with HHV-6B U20, these modifications may significantly impact protein function and interactions with host immune components .

Methodologically, researchers investigating U18 structure should consider approaches such as:

  • Recombinant expression in mammalian cell systems (e.g., Expi293) that maintain appropriate glycosylation patterns

  • Structural analysis through techniques like small-angle X-ray scattering (SAXS)

  • Mass spectrometry to identify specific post-translational modifications

  • Machine learning-based structural prediction to develop preliminary models

How does HHV-6B U18 expression vary across different phases of viral infection?

RNA sequencing studies of HHV-6B have demonstrated substantial variability in viral gene expression across different infection stages and sample types . While U38 (viral polymerase) has been identified as consistently expressed across samples during active infection, the expression pattern of U18 may vary depending on the infection phase and cell type.

To methodically investigate U18 expression patterns, researchers should:

  • Develop reverse transcription-PCR assays specific to U18 mRNA

  • Compare expression levels between latently infected cells and actively replicating virus

  • Analyze U18 expression in different tissue types, as viral transcript detection varies between tissues

  • Consider temporal analysis across the viral replication cycle to confirm immediate-early expression kinetics

What cell culture systems are recommended for studying recombinant HHV-6B U18?

For recombinant expression and functional studies of HHV-6B glycoproteins, several cell systems have proven effective. Based on successful approaches with other HHV-6B glycoproteins:

Expi293 cells have demonstrated efficient expression and appropriate glycosylation of viral glycoproteins like ULBP1-Fc and could be suitable for U18 expression . T-cell lines are relevant biological models as they represent natural targets of HHV-6B infection . Alternatively, lymphoblastoid cell lines (LCLs) can be used to study latent infection contexts.

The methodological approach should include:

  • Transient transfection protocols optimized for glycoprotein expression

  • Purification strategies incorporating size exclusion chromatography

  • Verification of glycosylation status through EndoH or PNGaseF digestion followed by mass spectrometry

  • Establishment of stable cell lines for long-term expression studies

What are the optimal approaches for differentiating between active and latent HHV-6B when studying U18 function?

Distinguishing between active and latent HHV-6B infection presents a significant challenge in research settings, particularly in samples from individuals with chromosomally integrated HHV-6B (iciHHV-6B). RNA-based detection methods offer advantages over DNA-based approaches in this context.

For U18-focused research, consider the following methodological strategy:

  • Develop a reverse transcription-quantitative PCR (RT-qPCR) assay targeting U18 mRNA, similar to approaches used for U38

  • Incorporate RNA sequencing to assess full transcriptome profiles

  • Compare U18 expression in blood samples from subjects with active viremia versus latently infected cells

  • Include controls from individuals with iciHHV-6B to distinguish germline-integrated virus from active infection

RNA sequencing data has revealed that viral polymerase gene U38 is consistently expressed during active infection but absent during latency, making it a valuable reference point when studying U18 expression patterns .

How might U18 interact with host immune components based on knowledge of other HHV-6B glycoproteins?

HHV-6B glycoproteins play critical roles in immune evasion. The U20 glycoprotein binds to ULBP1 with sub-micromolar affinity (Kd = 0.41 μM), masking it from recognition by the NK cell activating receptor NKG2D . Similarly, U21 targets MHC-I molecules for lysosomal degradation . These mechanisms suggest potential immunomodulatory functions for U18.

To investigate U18's potential immune interactions:

  • Perform binding studies with recombinant U18 against candidate immune ligands

  • Assess changes in surface expression of immune recognition molecules in U18-expressing cells

  • Conduct co-immunoprecipitation experiments to identify potential binding partners

  • Implement functional assays to measure NK cell and T cell activation in the presence of U18

What genomic variation exists in the U18 gene across different HHV-6B clinical isolates?

HHV-6B exhibits genomic variation that can be exploited for strain discrimination and transmission tracking. The DR R-pvT1 region has been used effectively to distinguish between different HHV-6B strains . Similar approaches could be applied to analyze U18 variation.

Methodologically, researchers should:

  • Sequence the U18 gene across multiple clinical isolates

  • Compare sequences between community-acquired and chromosomally integrated HHV-6B

  • Analyze selective pressure on U18 through calculation of synonymous/non-synonymous substitution rates

  • Correlate genetic variations with functional differences through recombinant expression of variant forms

This approach has successfully identified 61/63 different DR R-pvT1 sequences in saliva samples from healthy non-iciHHV-6B donors in the UK, demonstrating the utility of sequence analysis for strain discrimination .

What purification strategy is recommended for obtaining high-quality recombinant HHV-6B U18 protein?

Based on successful approaches for other HHV-6B glycoproteins, a multi-step purification strategy is recommended:

  • Expression system: Transient transfection of Expi293 cells with a construct containing the U18 extracellular domain fused to a purification tag (either 6xHIS or Fc)

  • Initial purification: For His-tagged constructs, utilize Nickel-NTA chromatography; for Fc-fusion proteins, employ protein A chromatography

  • Secondary purification: Size exclusion chromatography using a Superdex 200 Increase 10/300 GL column

  • Quality control: SDS-PAGE analysis of purified protein under reducing conditions

  • Optional tag removal: If necessary, incorporate a protease cleavage site (e.g., Factor Xa) for tag removal

This approach has yielded high-quality soluble preparations of other HHV-6B glycoproteins that maintain biological activity, making it suitable for U18 purification .

How can researchers effectively measure U18 glycoprotein interactions with host cellular proteins?

Multiple complementary approaches should be used to characterize U18-host protein interactions:

  • Surface Plasmon Resonance (SPR): Determine binding kinetics and affinity constants using purified recombinant U18 and candidate host proteins

  • Flow cytometry: Assess U18 binding to cell surface molecules using fluorescently labeled protein

  • Co-immunoprecipitation: Identify novel binding partners in lysates from infected or transfected cells

  • Functional assays: Measure the impact of U18 expression on specific cellular functions

When designing interaction studies, researchers should be aware that antibody binding to target proteins may be affected by U18 binding, as observed with U20 and anti-ULBP1 antibodies, where soluble U20 at concentrations as low as 0.125 μM reduced antibody binding by 60% .

What approaches can differentiate between U18's direct effects and secondary consequences of viral infection?

Distinguishing direct U18 effects from broader viral infection impacts requires controlled experimental designs:

  • Isolated expression systems: Express U18 alone in relevant cell types via transduction or transfection

  • Comparative analysis: Compare U18 expression effects with those of other viral glycoproteins (U20, U21)

  • Mutational studies: Generate U18 point mutants to identify functional domains

  • Knockout/knock-in approaches: Create recombinant viruses with U18 deletions or modifications

How should researchers interpret transcriptomic data when studying U18 expression during HHV-6B infection?

Transcriptomic analysis of HHV-6B infection requires careful interpretation due to the variability in viral gene expression across samples. When analyzing RNA sequencing data for U18:

  • Normalize expression data appropriately across samples

  • Compare U18 expression to established viral gene markers (e.g., U38) for infection stage classification

  • Account for tissue-specific differences in viral gene expression

  • Consider time-course data to capture temporal expression patterns

In published RNA-seq datasets, HHV-6B gene expression showed substantial overlap between in vivo and in vitro samples, but with significant variability in breadth and quantity of gene expression . Researchers should therefore collect sufficient biological replicates to account for this variability.

What statistical approaches are recommended for analyzing U18 binding affinity data?

When analyzing binding affinity data for U18-host protein interactions:

  • For SPR data:

    • Fit association and dissociation curves to appropriate kinetic models

    • Calculate kon, koff, and equilibrium dissociation constant (Kd)

    • Compare multiple binding models (1:1, heterogeneous ligand, etc.) using residual analysis

  • For dose-response experiments:

    • Use nonlinear regression to calculate EC50/IC50 values

    • Apply appropriate transformations for data that doesn't follow standard models

    • Include appropriate controls for non-specific binding

  • For all binding studies:

    • Report both affinity constants and confidence intervals

    • Include replicates (minimum n=3) for statistical robustness

    • Consider the impact of protein glycosylation on binding parameters

As a reference, HHV-6B U20 binding to ULBP1 demonstrated sub-micromolar affinity (Kd = 0.41 μM) , providing a benchmark for interpreting U18 binding data.

How can structural modeling inform understanding of U18 function in the absence of crystal structures?

In the absence of crystallographic data, several computational and experimental approaches can inform U18 structural models:

  • Machine learning-based structure prediction using tools like AlphaFold

  • Homology modeling based on related viral glycoproteins

  • Integration of small-angle X-ray scattering (SAXS) data to validate computational models

  • Molecular dynamics simulations to assess structural stability and dynamics

These models should be refined through experimental validation, including:

  • Epitope mapping with site-directed mutagenesis

  • Limited proteolysis to identify domain boundaries

  • Glycosylation site analysis through mass spectrometry

This combined approach successfully generated structural models of the U20-ULBP1 complex, revealing similarities to the m152-RAE1γ complex and demonstrating occlusion of the NKG2D binding site on ULBP1 .

How might research on U18 inform diagnostic approaches for distinguishing active from latent HHV-6B infection?

Understanding U18 expression patterns and function could contribute to improved diagnostic approaches for HHV-6B. Currently, distinguishing between latent and active viral infection remains challenging, particularly in immunocompromised patients .

If U18 shows consistent expression during active replication:

  • Develop RT-qPCR assays targeting U18 mRNA in clinical samples

  • Establish expression thresholds that correlate with symptomatic infection

  • Create multiplex assays incorporating U18 and other viral transcripts like U38

  • Evaluate U18 expression in samples from patients with inherited chromosomally integrated HHV-6B versus active infection

The U38 transcript has been identified as a potential marker for active infection, detected in all whole-blood samples from patients with concurrent HHV-6B viremia but absent in samples without HHV-6B plasma detection or from latently infected cells . Similar validation would be necessary for U18-based diagnostics.

What roles might U18 play in HHV-6B pathogenesis and how can this inform therapeutic approaches?

HHV-6B reactivation has been associated with several serious conditions, including viral encephalitis, drug-induced hypersensitivity syndrome, and acute graft-versus-host disease . Understanding U18's contribution to these pathologies could inform therapeutic strategies.

Research approaches should include:

  • Analysis of U18 expression in clinical samples from patients with HHV-6B-associated diseases

  • Investigation of U18's potential role in immune evasion, similar to U20's masking of ULBP1 from NK cells

  • Assessment of U18 as a potential therapeutic target through neutralizing antibodies or small molecule inhibitors

  • Evaluation of U18 sequence variants in patients with different clinical manifestations of HHV-6B infection

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.