Recombinant Human herpesvirus 6B Putative OX-2 membrane glycoprotein homolog (U85)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
U85; Putative OX-2 membrane glycoprotein homolog; Protein U85
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-292
Protein Length
Full Length of Mature Protein
Species
Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus)
Target Names
U85
Target Protein Sequence
HFVPRPETSPSLVYEIGSTVTFHCRLNTTTNIQSVSWYNKSRLISNHEIQNMDNLSFTDD GYVFIHELNKINNLDVDSKLYFHIKHDRTTSLLKIKARSAYDATCLTCTFTVDNEKTSAT SCLKLIMKPIVVLYFRYLNNFLDVTCTVTSYPKPNVVIKFLGEVYKRDIPMVRQNENGSS TVSVSFTFKRRTKLEFVGKTISCLASSWFTNQKASALVTSGEHTVQNHDEYSKEAVKGSN SDETVFTWIVPLILILIISVMVLLISMCIVAFKS
Uniprot No.

Target Background

Database Links

KEGG: vg:1497085

Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What is the Human herpesvirus 6B U85 glycoprotein and what is its significance in viral biology?

The U85 glycoprotein of Human herpesvirus 6B (HHV-6B) is a putative OX-2 membrane glycoprotein homolog. It represents one of the 97 unique genes within the HHV-6B genome, which spans approximately 162,114 bp . The glycoprotein is believed to play a role in viral immune evasion strategies, similar to other viral membrane proteins like the β-chemokine receptor encoded by U12 .

While less extensively characterized than some other HHV-6B proteins, U85 is of particular interest because membrane glycoproteins often mediate crucial virus-host interactions. The OX-2 homology suggests potential involvement in immunomodulatory functions, as cellular OX-2 (CD200) typically delivers inhibitory signals to myeloid cells expressing CD200R, potentially helping the virus evade immune detection and clearance.

What expression systems are typically used for producing recombinant HHV-6B U85 protein?

For recombinant expression of HHV-6B proteins including U85, researchers typically employ several expression systems:

  • Bacterial expression systems: E. coli-based systems using vectors like pET or pGEX for GST-fusion proteins are common for initial studies, though they lack post-translational modifications critical for glycoproteins.

  • Mammalian expression systems: Human cell lines such as HEK293T or HeLa cells transfected with mammalian expression vectors (pcDNA, pCMV) are preferred for maintaining proper folding and post-translational modifications of membrane glycoproteins.

  • Insect cell systems: Baculovirus expression systems using Sf9 or High Five insect cells provide a compromise between bacterial and mammalian systems, offering some post-translational modifications with higher yield.

For membrane glycoproteins like U85, mammalian expression systems are generally optimal as they provide the native environment for proper folding, glycosylation, and membrane insertion. Commercial recombinant U85 preparations like those referenced in the search results likely utilize such systems to ensure proper protein conformation .

What approaches can be employed to study potential protein-protein interactions of HHV-6B U85 with host immune components?

Given U85's putative OX-2 homology and potential role in immune evasion, investigating its protein-protein interactions with host immune components is crucial. Several complementary approaches can be employed:

  • Co-immunoprecipitation (Co-IP) assays:

    • Express tagged recombinant U85 in relevant cell types

    • Perform pull-down experiments followed by mass spectrometry to identify interaction partners

    • Validate specific interactions with candidate immune components (e.g., CD200R family members)

  • Proximity-based labeling techniques:

    • BioID or APEX2 fusions to label proteins in proximity to U85 in living cells

    • TurboID for rapid labeling of interaction partners

    • Particularly useful for capturing transient or weak interactions

  • Surface plasmon resonance (SPR):

    • Immobilize purified recombinant U85 on sensor chips

    • Measure binding kinetics with purified candidate interacting proteins

    • Determine binding affinities (Kd values) for comparative analyses

  • Cryo-electron microscopy:

    • Structural determination of U85 alone and in complex with binding partners

    • Provides atomic-level detail of interaction interfaces

  • Functional validation in cell culture:

    • U85 knockout/knockdown studies using CRISPR-Cas9 or RNAi

    • U85 overexpression followed by immune response assays (cytokine production, immune cell activation)

    • Co-culture experiments with relevant immune cell populations

The experimental approach should incorporate both unbiased screening methods to identify novel interactions and targeted validation of predicted interactions based on homology to cellular OX-2.

How do the genomic and proteomic characteristics of HHV-6B U85 compare with its homolog in HHV-6A?

Comparative analysis between HHV-6A and HHV-6B homologs provides valuable insights into conservation and divergence of function. For U85 specifically:

Comprehensive analysis would identify whether U85 shows the high conservation of essential viral functions or divergence suggesting host-specific adaptations.

What are the optimal approaches for studying the kinetic class and temporal expression patterns of HHV-6B U85?

To determine the kinetic class and temporal expression pattern of U85, researchers can adapt methodologies used for comprehensive HHV-6B transcriptome analysis:

  • Time course experimental design:

    • Infect susceptible cells (e.g., Molt-3 T cells) with HHV-6B

    • Collect samples at multiple timepoints (6, 9, 12, 24, 48, 72 hours post-infection)

    • Include specific inhibitor conditions:

      • Cycloheximide (CHX): Protein synthesis inhibitor to identify immediate-early genes

      • Phosphonoacetic acid (PAA): DNA replication inhibitor to distinguish early from late genes

  • Multi-omics approach:

    • RNA-seq: Measure transcript abundance across timepoints

    • Ribosome profiling: Assess translation efficiency

    • Proteomics: Quantify protein levels

    • ChIP-seq: Analyze transcription factor binding and chromatin state

  • Data analysis methodology:

    • Generate heat maps showing relative expression across timepoints as demonstrated in previous HHV-6B studies

    • Apply kinetic class classification criteria:

      • Immediate-early (IE): Expressed in presence of CHX

      • Early (E): Expressed in presence of PAA but not CHX

      • Late (L): Not expressed in presence of PAA

  • Validation experiments:

    • RT-qPCR with gene-specific primers

    • Western blotting with time course samples

    • Immunofluorescence microscopy to visualize protein expression and localization

TimepointSample ConditionsExpected Results for Different Kinetic Classes
0-6 hoursUntreated, +CHXIE genes detectable in both conditions
9-24 hoursUntreated, +PAAIE and E genes detectable; L genes blocked by PAA
48-72 hoursUntreatedIE, E, and L genes all expressed

Previous HHV-6B studies have successfully applied this approach to classify genes into kinetic categories , providing a methodological template for U85 expression analysis.

How can ribosome profiling be applied to study translational dynamics of HHV-6B U85 and detect potential alternative translation products?

Ribosome profiling has been successfully applied to study HHV-6 translation, revealing hundreds of previously unrecognized open reading frames (ORFs) . For studying U85 translation specifically:

  • Experimental design considerations:

    • Time course sampling during HHV-6B infection

    • Cell lysis and ribosome isolation under conditions that preserve translation complexes

    • Nuclease digestion to generate ribosome-protected fragments (RPFs)

    • Size selection of ~28-30nt fragments representing ribosome footprints

    • Library preparation and deep sequencing

  • Detection of potential translation products:

    • Upstream ORFs (uORFs): Translation initiating upstream of the main U85 start codon

    • Internal ORFs (iORFs): Translation initiating within the U85 coding sequence

    • Alternative reading frames: Translation in +1 or +2 frames relative to the annotated U85 coding frame

  • Quantitative analysis:

    • Translation efficiency (TE) calculation: ratio of ribosome footprint density to mRNA abundance

    • Identification of translation initiation sites (TIS) using harringtonine or lactimidomycin treatments

    • Metagene analysis to identify ribosome pausing or stalling sites

  • Integration with other data types:

    • Combine with RNA-seq to calculate translation efficiency

    • Integrate with proteomics to validate translation products

    • Coordinate with transcription start site (TSS) mapping to identify potential regulatory elements

Previous HHV-6 studies identified numerous uORFs enriched in late viral genes , and similar patterns might apply to U85 if it contains regulatory upstream elements or produces multiple protein isoforms.

What methodological approaches are most effective for studying potential roles of U85 in HHV-6B immune evasion?

Given the putative OX-2 homology of U85 and the established role of viral immune evasion strategies in HHV-6B , several methodological approaches can effectively investigate U85's potential immunomodulatory functions:

  • Recombinant protein functional assays:

    • Express and purify recombinant U85 protein

    • Test binding to candidate immune receptors (CD200R family)

    • Assess effects on immune cell activation, cytokine production, and signaling pathways

  • Cell-based functional assays:

    • Overexpression of U85 in relevant cell types

    • Co-culture with immune cells (T cells, monocytes, NK cells)

    • Measure functional outcomes:

      • Cytokine production

      • Cytotoxic activity

      • Cell proliferation

      • Receptor downregulation

  • Virus mutant generation and characterization:

    • Generate U85-knockout or U85-modified HHV-6B

    • Compare replication in immunocompetent vs. immunodeficient systems

    • Assess immune response to mutant vs. wild-type virus

  • In vivo models:

    • Humanized mouse models for HHV-6B infection

    • Comparative infection studies with wild-type and U85-mutant viruses

    • Immune cell profiling and functional assessment

  • Experimental data collection matrix:

Experimental ModelReadout MeasurementsControlsExpected Results if U85 Mediates Immune Evasion
U85-transfected cellsImmune activation markers, cytokine productionEmpty vector, irrelevant proteinSuppression of immune activation
Co-culture of U85+ cells with immune effectorsCytotoxicity, proliferationCo-culture with U85- cellsReduced immune effector function
U85 knockout virusViral replication, immune clearanceWild-type virusAttenuated replication, enhanced clearance
Recombinant U85 proteinBinding to CD200R, signalingMutated U85, cellular OX-2Engagement of inhibitory receptors

An integrated approach combining multiple methodologies would provide comprehensive insights into U85's potential role in HHV-6B immune evasion strategies, similar to studies that have characterized the immunomodulatory functions of the viral β-chemokine receptor encoded by U12 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.