Recombinant Human herpesvirus 7 Virion egress protein U34 (U34)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Human Herpesvirus 7 (HHV-7) Virion Egress Protein U34, commonly referred to as U34, is a conserved protein among all human herpesviruses . It plays a crucial role in the nuclear egress of viral capsids, which is essential for viral replication .

  • Taxonomic Identification U34 is found in Human herpesvirus 7 (strain JI), also known as HHV-7 or Human T lymphotropic virus . The taxonomic identifier for HHV-7 is 57278 (NCBI) .

Function and Role in Viral Replication

U34 is involved in the primary envelopment of herpes simplex virus (HSV) nucleocapsids, which bud from the inner nuclear membrane (INM) to form nascent virions . Recent studies suggest that HSV-1 particles lose this primary envelope and acquire a secondary envelope in the cytoplasm .

U34 Homologues in Other Herpesviruses

U34 has homologues in other herpesviruses, such as UL50 in Human Cytomegalovirus (HCMV) and UL34 in Herpes Simplex Virus 1 (HSV-1) . These homologues share similar functions in nuclear egress .

HerpesvirusU34 HomologueFunction
Herpes Simplex Virus 1 (HSV-1)UL34Forms NEC with UL31, essential for primary envelopment and nuclear egress .
Human Cytomegalovirus (HCMV)UL50Forms NEC with UL53, crucial for viral capsid export from the nucleus .
Human Herpesvirus 6A (HHV-6A)U34Interacts with U37, affecting intracellular signaling and potentially masking HSE stimulation .

Role in Immune Evasion and Pathogenesis

HHV-7 employs various strategies to evade the host's immune system, including downregulating the expression of class I major histocompatibility complex (MHC I) on infected cells . While the specific role of U34 in immune evasion is not directly established, other HHV-7 proteins like U21 contribute to this process by associating with class I MHC molecules and diverting them to lysosomes for degradation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
NEC2; U34; Nuclear egress protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-258
Protein Length
full length protein
Species
Human herpesvirus 7 (strain JI) (HHV-7) (Human T lymphotropic virus)
Target Names
NEC2
Target Protein Sequence
MLKEKMYDELILSTCRVLKLGPADFRVTDKNLFSKNPKFPLCDILLKLDFAYSLEYLLSL WEDLTKQEARFIFKNTGGAVSMSCYLHAPIKQESQNIVKECNILNVNECLSVCLNDIEAI KPSSSGVLTKCIIRRNRDAAFIVEFVAFGPESESEYIALLKAIILKKKFLERQDLEKHRA ARHIKKPLRLQLKSVGEMTSFRSINYMGNTKDAAVFPVTVPIFARRNNILCGFLVAALLI VCYVIFKEFALSADFSAV
Uniprot No.

Target Background

Function

Recombinant Human herpesvirus 7 Virion egress protein U34 (U34) plays a critical role in virion nuclear egress, the initial step of virion release from infected cells. Within the host nucleus, U34 interacts with the newly formed capsid via its vertices, directing it to the inner nuclear membrane through its association with NEC2. U34 induces capsid budding at the inner nuclear membrane and its subsequent envelopment within the perinuclear space. The U34/NEC2 complex then facilitates fusion of the enveloped capsid with the outer nuclear membrane, releasing the viral capsid into the cytoplasm, where it proceeds to secondary budding sites in the host Golgi or trans-Golgi network.

Database Links

KEGG: vg:3289492

Protein Families
Herpesviridae NEC2 protein family
Subcellular Location
Host nucleus inner membrane; Single-pass membrane protein.

Q&A

What is HHV-7 U34 protein and what is its role in viral replication?

U34 is a 258 amino acid virion egress protein (also known as Nuclear Egress Protein 2 or NEC2) encoded by Human herpesvirus 7 (HHV-7). It plays a critical role in the nuclear egress pathway of herpesviruses, facilitating the transport of viral nucleocapsids from the nucleus to the cytoplasm during viral replication . U34 is part of the nuclear egress complex (NEC), which creates an exit portal in the nuclear membrane, allowing herpesvirus nucleocapsids to transit from the nucleus to the cytoplasm. This process is essential for productive viral infection, as herpesviruses assemble their capsids within the nucleus but mature in the cytoplasm .

How does HHV-7 U34 compare structurally and functionally to its homologs in other herpesviruses?

HHV-7 U34 is homologous to HSV UL34 and HCMV UL50, sharing similar functions in nuclear egress. Structural analyses of nuclear egress complexes from HSV-1, EBV, and HCMV have revealed that they form hexagonal lattices through inter-molecular interactions . HHV-7 U34 likely adopts a similar structure and mechanism as its homologs, but with some virus-specific variations.

The amino acid sequence of HHV-7 U34 (MLKEKMYDELILSTCRVLKLGPADFRVTDKNLFSKNPKFPLCDILLKLDFAYSLEYLLSLWEDLTKQEARFIFKNTGGAVSMSCYLHAPIKQESQNIVKECNILNVNECLSVCLNDIEAIKPSSSGVLTKCIIRRNRDAAFIVEFVAFGPESESEYIALLKAIILKKKFLERQDLEKHRAARHIKKPLRLQLKSVGEMTSFRSINYMGNTKDAAVFPVTVPIFARRNNILCGFLVAALLIVCYVIFKEFALSADFSAV) features transmembrane domains characteristic of type II membrane proteins, with a cytoplasmic N-terminal domain and a C-terminal domain anchored in the nuclear membrane, similar to its herpesvirus homologs .

What is the genomic context of the U34 gene in the HHV-7 genome?

The U34 gene is located within the unique (U) region of the HHV-7 genome. The complete HHV-7 genome consists of a central unique segment approximately 133 kb in length, flanked by 10-kb-long end-terminal direct repeat (DR) regions on each side . U34 is positioned among the core set of genes conserved across betaherpesviruses. The origin of lytic replication (oriLyt) is located upstream of the major DNA-binding protein gene U41, relatively close to the U34 gene in the genomic arrangement .

What expression systems are most effective for producing recombinant HHV-7 U34 protein?

Recombinant HHV-7 U34 protein has been successfully expressed in several systems:

  • E. coli expression system: This is the most commonly used approach, yielding protein with purity greater than 90%. The protein can be expressed with an N-terminal His-tag to facilitate purification .

  • Cell-free expression systems: These have been used for producing U34 with purity of approximately 85% .

  • Baculovirus and mammalian cell expression systems: These systems may provide better post-translational modifications but are less commonly reported for U34 specifically .

The choice of expression system depends on the research requirements. For structural studies requiring high purity and quantity, E. coli systems are preferred. For functional studies where post-translational modifications may be important, mammalian expression systems might be more appropriate.

What purification strategies yield the highest purity and functional integrity of recombinant U34?

For His-tagged U34 protein expressed in E. coli, the following purification strategy is recommended:

  • Cell lysis under native or denaturing conditions depending on protein solubility

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Optional refolding step if the protein was purified under denaturing conditions

  • Size exclusion chromatography to remove aggregates and improve homogeneity

  • Concentration and storage in appropriate buffer (typically Tris/PBS-based buffer with 6% trehalose, pH 8.0)

For optimal results, protein purity should be assessed by SDS-PAGE and should exceed 90%. Western blot analysis using anti-His antibodies can confirm the identity of the purified protein.

How can researchers optimize protein yield and solubility when expressing HHV-7 U34?

Several strategies can improve yield and solubility:

  • Temperature optimization: Lowering induction temperature to 16-18°C can enhance proper folding

  • Codon optimization: Adapting the coding sequence to the expression host's codon usage bias

  • Fusion partners: Using solubility-enhancing fusion tags like SUMO, MBP, or GST

  • Expression strain selection: Testing multiple E. coli strains (e.g., BL21(DE3), Rosetta, SHuffle) to identify optimal expression

  • Buffer optimization: Screening different buffer conditions during purification

  • Induction optimization: Testing various IPTG concentrations and induction times

For membrane proteins like U34, using detergents or membrane-mimicking systems (nanodiscs, liposomes) during purification may help maintain native conformation and function.

What methods are most effective for studying U34 interactions with other viral and cellular proteins?

To study U34 protein interactions, researchers should consider:

  • Co-immunoprecipitation: Using tagged U34 (e.g., His-tagged or Strep-tagged) to pull down interacting partners followed by mass spectrometry identification

  • Yeast two-hybrid screening: For identifying novel protein interactions

  • Fluorescence microscopy: Visualizing co-localization of fluorescently tagged U34 with potential binding partners. This approach has successfully demonstrated U34-Strep relocalization to the nuclear rim in the presence of Flag-HHV-6A U37

  • Bimolecular fluorescence complementation (BiFC): For confirming direct interactions in living cells

  • Surface plasmon resonance or isothermal titration calorimetry: For quantitative binding kinetics

  • Proximity-based labeling techniques: BioID or APEX2 fusions to identify proximal proteins in the cellular context

These methods have revealed that U34 interacts with U37 to form the nuclear egress complex essential for viral replication .

How can researchers assess the function of U34 in the nuclear egress complex?

The function of U34 in the nuclear egress complex can be assessed using:

  • Fluorescence microscopy: Track the localization of fluorescently tagged U34 during viral infection or when co-expressed with U37. Normal function shows distinct nuclear rim localization

  • Electron microscopy: Visualize nucleocapsid accumulation at the nuclear membrane and primary envelopment events

  • Dominant-negative mutants: Express truncated or mutated versions of U34 to disrupt NEC function

  • CRISPR/Cas9 genome editing: Create U34 mutants in the viral genome to assess effects on viral replication

  • In vitro membrane bending assays: Reconstitute NEC components with artificial membranes to assess membrane deformation activity

Research has shown that when HHV-6A U34-Strep is co-expressed with Flag-HHV-6A U37, both proteins relocalize to the nuclear rim, suggesting formation of a functional NEC. The U34-U37 complex may form hexagonal lattices similar to those observed in other herpesviruses .

What is the relationship between U34 and the heat shock response in infected cells?

Intriguingly, research has shown that while HHV-6A U37 alone can activate the heat shock element promoter leading to accumulation of heat shock proteins, this activity is suppressed when U37 forms a complex with U34. This suggests that U34 may modulate the cellular stress response during infection .

A hypothesis worth investigating is whether this represents a temporal regulation mechanism during infection, where early expression of U37 triggers heat shock response (potentially beneficial for viral replication), while later formation of the U34-U37 complex suppresses this response to prevent cellular antiviral mechanisms.

Methods to investigate this relationship include:

  • Heat shock element (HSE) luciferase reporter assays in the presence of U34, U37, or both

  • qRT-PCR analysis of heat shock protein transcripts under various conditions

  • Temporal analysis of U34 and U37 expression during viral infection lifecycle

  • Deletion or mutation studies to identify domains responsible for heat shock regulation

How can researchers use recombinant U34 to develop diagnostic tools for HHV-7 infection?

HHV-7 infection poses diagnostic challenges due to high seroprevalence and cross-reactivity with HHV-6. While pp85(U14) serves as an immunodominant antigen for HHV-7 , recombinant U34 could potentially provide complementary diagnostic approaches:

Validation would require:

  • Testing against panels of confirmed HHV-7 positive and negative samples

  • Cross-reactivity assessment with HHV-6A/B and other herpesviruses

  • Comparison with existing diagnostic methods

  • Sensitivity and specificity determination in various clinical contexts

What approaches can be used to develop recombinant U34-based vaccines or antiviral strategies against HHV-7?

While no vaccines currently exist for HHV-7, recombinant U34 could potentially be leveraged for vaccine development through:

  • Subunit vaccine: Purified recombinant U34 formulated with appropriate adjuvants

  • Viral vector-based vaccine: Expression of U34 in attenuated viral vectors (e.g., modified vaccinia Ankara)

  • DNA vaccine: Plasmid encoding U34 for direct transfection and in vivo expression

  • Peptide vaccine: Immunogenic epitopes from U34 identified through epitope mapping

For antiviral development, researchers could:

  • Screen for small molecule inhibitors that disrupt U34-U37 interaction using:

    • High-throughput binding assays

    • Cell-based nuclear egress inhibition assays

    • Structure-based virtual screening if crystal structures become available

  • Develop peptide inhibitors that competitively inhibit formation of the nuclear egress complex

  • Test antibody-based therapeutics targeting accessible epitopes of U34 during viral egress

Efficacy testing would require appropriate in vitro systems and potentially the MneHV7 macaque model, which offers a relevant animal model for HHV-7 research .

How can the macaque MneHV7 model be utilized to study U34 function in vivo?

The discovery of Macaca nemestrina herpesvirus 7 (MneHV7) provides an important animal model for HHV-7 research . For U34 studies, researchers could:

  • Compare sequence homology between HHV-7 U34 and MneHV7 U34 to establish conservation of functional domains

  • Generate recombinant MneHV7 with tagged or mutated U34 to track expression patterns during infection

  • Perform immunohistochemistry in infected macaque tissues using anti-U34 antibodies to determine protein localization in vivo

  • Analyze U34 expression profiles in different tissues and infection stages using RNA-seq approaches

  • Test U34-targeting antivirals in the macaque model before proceeding to human clinical trials

The macaque model offers particular advantages for studying:

  • Natural infection dynamics

  • Tissue tropism (including salivary gland and peripheral nerve ganglia)

  • Viral latency and reactivation

  • Immune responses to viral proteins including U34

What controls should be included when studying U34 interactions with host cell components?

Rigorous controls are essential when studying U34 interactions:

  • Negative controls:

    • Empty vector transfections

    • Irrelevant protein of similar size/structure

    • Cells expressing U34 with mutations in predicted interaction domains

    • Isotype control antibodies for immunoprecipitation

  • Positive controls:

    • Known interaction partners (e.g., U37)

    • Other herpesvirus homologs with established interactions (HSV UL34)

  • Expression level controls:

    • Western blot verification of protein expression

    • Titration of expression levels to avoid artifacts from overexpression

    • Use of inducible expression systems to control expression timing

  • Localization controls:

    • Markers for different cellular compartments (nuclear membrane, ER, Golgi)

    • Co-expression with established NEC components from other herpesviruses

How should researchers address the technical challenges of working with a membrane-associated protein like U34?

Membrane proteins present specific challenges:

  • Solubilization strategies:

    • Screen multiple detergents (DDM, CHAPS, digitonin) for optimal solubilization

    • Consider native nanodiscs or styrene maleic acid lipid particles (SMALPs)

    • Use lipid reconstitution for functional studies

  • Expression system selection:

    • Test both prokaryotic and eukaryotic systems

    • Consider cell-free systems with added microsomes for membrane proteins

    • Use specialized E. coli strains designed for membrane protein expression

  • Purification modifications:

    • Include detergent in all purification buffers

    • Optimize detergent concentration to prevent aggregation

    • Consider on-column detergent exchange

  • Functional verification:

    • Circular dichroism to confirm secondary structure retention

    • Liposome binding assays to verify membrane interaction capability

    • Reconstitution in artificial membranes to assess function

How can contradictory data about U34 function be reconciled in the context of different experimental systems?

When facing contradictory data:

  • Compare experimental conditions systematically:

    • Cell types used (may affect post-translational modifications)

    • Expression levels (overexpression artifacts)

    • Tags and fusion partners (may interfere with function)

    • Viral strain differences (U34 may differ between HHV-7 strains)

  • Consider protein partnerships:

    • U34 behavior likely depends on presence of other viral proteins

    • U37 co-expression dramatically changes U34 localization and function

    • Host cell factors may vary between experimental systems

  • Temporal aspects:

    • Function may differ at different stages of viral lifecycle

    • Dynamic regulation of localization and interactions

  • Reconciliation approaches:

    • Create a standardized experimental pipeline for comparative studies

    • Use multiple complementary techniques to verify findings

    • Develop an integrated model that accommodates context-dependent functions

What are the critical knowledge gaps regarding U34 structure-function relationships?

Despite progress in understanding U34, several knowledge gaps remain:

  • High-resolution structure: No crystal or cryo-EM structure of HHV-7 U34 alone or in complex with U37 is currently available, limiting structure-based functional analysis and drug design

  • Post-translational modifications: Unknown whether U34 undergoes phosphorylation, glycosylation, or other modifications that might regulate its function

  • Interaction network: Comprehensive interaction partners beyond U37 remain to be identified

  • Strain variations: Potential functional differences between U34 from different HHV-7 isolates have not been characterized

  • Host specificity determinants: Features that distinguish human HHV-7 U34 from macaque MneHV7 U34 and their functional implications

Future research should prioritize structural biology approaches, comprehensive interactome analysis, and comparative studies between viral strains and host species.

What novel methodologies might advance our understanding of U34 function in the viral lifecycle?

Emerging technologies that could advance U34 research include:

  • Cryo-electron tomography: To visualize U34-mediated nuclear egress in infected cells at nanometer resolution

  • Single-molecule tracking: To monitor U34 dynamics during nuclear egress in live cells

  • Proximity labeling proteomics (BioID, APEX): To identify transient U34 interaction partners during different stages of infection

  • AlphaFold2 and structure prediction: To generate structural models of U34 and its complexes to guide experimental design

  • CRISPR interference/activation: To modulate host factors potentially involved in U34 function

  • Organoids and tissue-specific models: To study U34 in more physiologically relevant contexts, particularly in salivary gland and neuronal tissues where HHV-7 exhibits tropism

  • Super-resolution microscopy: To visualize the architecture of the nuclear egress complex at nanoscale resolution

These approaches could provide unprecedented insights into the dynamic function of U34 during the HHV-7 lifecycle.

Practical Research Data Table: HHV-7 U34 Comparative Analysis

FeatureHHV-7 U34HHV-6B U34HCMV UL50HSV-1 UL34
Protein Length258 aa Partial in databases 397 aa275 aa
Molecular Weight~30 kDa~30 kDa~43 kDa~30 kDa
Expression SystemsE. coli, Cell-free E. coli, Yeast, Baculovirus, Mammalian Multiple systemsMultiple systems
Localization Without NEC PartnerCytoplasmic membranous structures Similar to HHV-7 U34ER membranesER membranes
Localization With NEC PartnerNuclear rim Nuclear rimNuclear rimNuclear rim
NEC PartnerU37 U37UL53UL31
Effect on Heat Shock ResponseSuppresses U37-mediated HSE activation Not determinedNot determinedNot determined
Purification Yield in E. coliHigh (>90% purity) High (>85% purity) VariableVariable
Storage StabilityStable with 6% trehalose, pH 8.0 Not specifiedNot specifiedNot specified

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.