Recombinant Human herpesvirus 8 type P G-protein coupled receptor homolog 74 (74)

Shipped with Ice Packs
In Stock

Description

Functional Role in HHV-8 Biology

ORF74-encoded vGPCR is a constitutively active receptor that promotes HHV-8 lytic replication through signaling pathways:

Key Mechanisms

  • Gα Coupling Specificity: Preferential activation of Gα<sub>q</sub> over Gα<sub>i</sub> drives mitogen-activated protein kinase (MAPK) signaling, enhancing viral genome replication .

  • Autocrine Signaling: vGPCR expression induces angiogenic cytokines (e.g., VEGF, IL-6) and supports cell survival during lytic reactivation .

  • Replication Enhancement: Knockout (ΔORF74) and knockdown (shRNA) experiments in PEL and endothelial cells demonstrated 50–70% reduced viral titers, rescued by wild-type vGPCR complementation .

Pathway Activation

Signaling PathwayFunctional OutcomeExperimental Evidence
MAPK/ERKIncreased viral genome replicationBacmid-based qPCR in HEK293T cells
Phosphatidylinositol 3-kinaseLimited contribution to replicationGα<sub>i</sub>-coupled mutant studies
NF-κBMinimal direct roleMutant vGPCR.8 (Gα<sub>i</sub>-specific)

Research Applications

This recombinant protein is utilized in:

  • Mechanistic Studies: Elucidating HHV-8 lytic cycle regulation and MAPK-dependent replication .

  • Drug Screening: Targeting vGPCR’s constitutive activity to inhibit HHV-8 replication .

  • Structural Biology: Mapping ligand-binding domains and G-protein interaction sites .

Table 1: Critical Research Outcomes

Study ModelMethodResultCitation
Bacmid ΔORF74 HHV-8qPCR post-TPA/RTA induction60% reduction in viral genome copies
TIME endothelial cellsshRNA-mediated vGPCR knockdown55% decrease in cumulative virus titers
MHV-68 ORF74 homologChemokine-induced replicationELR+ chemokines enhance wild-type replication

Notable Observations

  • Cell-Type Specificity: vGPCR’s proreplication effects are pronounced in endothelial cells, suggesting tissue-specific signaling crosstalk .

  • Evolutionary Conservation: MAPK dependency is shared with murine gammaherpesvirus 68 (MHV-68) vGPCR, indicating a conserved mechanism .

Limitations and Future Directions

Current gaps include:

  • Mechanistic Detail: Precise viral gene targets of MAPK signaling remain undefined .

  • In Vivo Relevance: Most data derive from cell culture; animal models are needed to validate therapeutic targets .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we currently have in stock. However, if you have any specific requirements for the format, please indicate them in your order notes, and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, and additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it for your product.
Synonyms
ORF74; viral G-protein coupled receptor; vGPCR; Protein ORF74
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-342
Protein Length
full length protein
Species
Human herpesvirus 8 type P (isolate GK18) (HHV-8) (Kaposi's sarcoma-associated herpesvirus)
Target Names
ORF74
Target Protein Sequence
MAAEDFLTIFLDDDESWNETLNMSGYDYSGNFSLEVSVCEMTTVVPYTWNVGILSLIFLI NVLGNGLVTYIFCKHRSRAGAIDILLLGICLNSLCLSISLLAEVLMFLFPNIISTGLCRL EIFFYYLYVYLDIFSVVCVSLVRYLLVAYSTRSWPKKQSLGWVLTSAALLIALVLSGDAC RHRSRVVDPVSKQAMCYENAGNMTADWRLHVRTVSVTAGFLLPLALLILFYALTWCVVRR TKLQARRKVRGVIVAVVLLFFVFCFPYHVLNLLDTLLRRRWIRDSCYTRGLINVGLAVTS LLQALYSAVVPLIYSCLGSLFRQRMYGLFQSLRQSFMSGATT
Uniprot No.

Target Background

Function
This receptor signals constitutively through multiple pathways, including PI3K/AKT and mitogen- and stress-activated/MAP kinases. It promotes host cell proliferation and survival, regulates cell migration, stimulates angiogenesis, and recruits inflammatory cells, both in expressing cells and neighboring cells. It also maintains chronic activation of NF-kappa-B through interaction with host CADM1.
Gene References Into Functions
  1. Research has shown that the viral orthologues e127 from rat cytomegalovirus and K14 from human herpesvirus 8 do not bind to the activating CD200R-like proteins in their respective species, although they do bind to the inhibitory receptors. PMID: 26538068
  2. This study identified a novel pathway, the Wnt/beta-catenin pathway, which is dysregulated by vGPCR expression in endothelial cells. PMID: 25514828
  3. SWAP70 appears to act as a molecular intermediary between vGPCR and endothelial activation. PMID: 25889342
  4. Data indicate that in NIH3T3 cells expressing unsulfated vGPCR mutant (yydd-vGN) but not vGPCR (wt-vGN) could significantly inhibit the tumor growth triggered by hGRO-alpha. PMID: 23269549
  5. By suppressing cis-acting AU-rich elements-mRNA turnover, vGPCR may facilitate the escape of certain target mRNAs from host shutoff and allow the secretion of angiogenic factors from lytically infected cells. PMID: 22696654
  6. The TSC/mTOR/HIF axis is activated by the KSHV vGPCR in Kaposi's sarcoma, which amplifies the angiogenic signal. PMID: 21559457
  7. Phosphorylation and polyubiquitination of TAK1 are necessary for the activation of NF-kappaB by the Kaposi's sarcoma-associated herpesvirus vGPCR. PMID: 21159881
  8. Research has demonstrated that vGPCR contains a bona fide immunoreceptor tyrosine-based inhibitory motif (ITIM) that binds and constitutively activates Shp2. PMID: 21047965
  9. vGPCR up-regulation of ANGPTL4 plays a significant role in promoting the angiogenesis and vessel permeability observed in Kaposi's sarcoma. PMID: 20660728

Show More

Hide All

Database Links

KEGG: vg:4961460

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Host cell membrane; Multi-pass membrane protein.

Q&A

What is the structural and functional classification of HHV-8 ORF74?

HHV-8 ORF74 encodes a viral G protein-coupled receptor (vGPCR) that is structurally related to chemokine receptors. This receptor has structural and functional homologues among other characterized gammaherpesviruses, with related receptors also found in betaherpesviruses . The vGPCR specified by ORF74 is a ligand-independent chemokine receptor that constitutively activates multiple signaling pathways . Sequence comparisons of gammaherpesvirus vGPCRs have revealed a highly conserved region in the C-tail, just distal to the seventh transmembrane domain, which contains determinants of G protein coupling specificity . The receptor couples with different G proteins, with specific receptor residues in the proximal region of the cytoplasmic tail serving as critical determinants of Gα protein coupling preferences .

The vGPCR is expressed during lytic replication as an early or early-late protein, suggesting its primary role is to mediate signal transduction that enhances viral replication . Unlike many cellular GPCRs that require ligand binding for activation, the HHV-8 vGPCR exhibits constitutive activity, continuously signaling in the absence of ligand stimulation . The receptor contains discrete sites for Gα protein interaction, with distinct domains mediating physical association with G proteins versus functional coupling and downstream signaling activation . This structural organization allows the receptor to simultaneously interact with multiple signaling pathways, contributing to its diverse biological effects.

What is the role of vGPCR in HHV-8 replication and viral biology?

The HHV-8 vGPCR functions as a positive regulator of viral productive replication, as demonstrated through gene knockout, depletion, and gain-of-function experiments . When the ORF74 gene is deleted or disrupted in recombinant HHV-8 genomes, significant decreases in both TPA- and RTA-induced genome copy numbers are observed relative to native and repaired genomes . This phenotype is specifically associated with vGPCR deficiency rather than ORF74 locus disruption, as frameshifted vGPCR variants show similarly reduced replication capacity . The proreplication activity of vGPCR appears to involve direct autocrine effects of receptor signaling in support of lytic replication .

Depletion of vGPCR using specific shRNAs in primary effusion lymphoma (PEL) cells naturally infected with HHV-8 results in significant reductions in virus titers following lytic reactivation . Similarly, vGPCR depletion in endothelial (TIME) cells infected with BCBL-1-derived virus leads to decreased cumulative HHV-8 titers over extended periods . Conversely, overexpression of vGPCR in TPA-treated HHV-8-infected TIME cultures enhances virus production, further confirming the functional significance of this receptor in promoting viral replication . These findings collectively establish that HHV-8 vGPCR, like some other herpesvirus-encoded chemokine receptors, plays an important autocrine role in supporting productive replication .

What signaling pathways does HHV-8 vGPCR activate and how do they influence viral replication?

HHV-8 vGPCR activates multiple signaling pathways, including NF-κB, mitogen-activated protein kinase (MAPK), and calcium mobilization pathways . The receptor can couple with different G proteins, particularly Gαq and Gαi, leading to activation of distinct downstream signaling cascades . Signaling via Gαq activation and targeted MAPK pathways appears to be of particular relevance to vGPCR's proreplication activity . In contrast, NF-κB signaling, which is associated with Gαi coupling, may be less critical for viral replication .

Experiments utilizing Gα-coupling variants of vGPCR have provided important insights into the specific signaling mechanisms underlying its proreplication function . The vGPCR.8 variant (R322W), which couples specifically to Gαi, is impaired in supporting virus production, whereas the vGPCR.15 variant (M325S), which couples predominantly with Gαq, maintains normal replication-enhancing activity . This suggests that Gαq-mediated signal transduction, which strongly activates MAPK signaling via phospholipase C, is of primary importance in promoting HHV-8 replication . Interestingly, MAPK/extracellular signal-regulated kinase signaling has also been identified as important for the proreplication activity of murine gammaherpesvirus 68 vGPCR, suggesting this may be a general mechanism by which viral chemokine receptors promote replication .

How do specific mutations in vGPCR affect G protein coupling and downstream signaling?

Research has identified specific amino acid residues in the C-tail region of HHV-8 vGPCR that determine G protein coupling specificity . The R322W mutation (designated vGPCR.8) makes the receptor specifically couple to Gαi, while the M325S mutation (designated vGPCR.15) leads to predominant coupling with Gαq . These mutations affect functional coupling without altering the physical association between the receptor and G proteins, as both variants, along with wild-type vGPCR and a C-tail deletion version, are equally able to associate physically with Gαq . This suggests that receptor-G protein interactions involve at least two components: physical association and functional coupling, which are mediated by distinct domains .

The differential G protein coupling of these vGPCR variants leads to activation of distinct downstream signaling pathways . The vGPCR.8 variant (Gαi-specific) signals predominantly via phosphatidylinositol 3-kinase/NF-κB pathways, while the vGPCR.15 variant (coupling preferentially with Gαq) activates protein kinase C/MAPK pathways . These differences in signaling have functional consequences, as demonstrated by the impaired virus production associated with the vGPCR.8 variant and the unaffected replication of the vGPCR.15 variant . These findings indicate that MAPK signaling may be particularly important for the proreplication activities of vGPCR, while NF-κB signaling appears less critical in this context .

GTPγS incorporation assays have confirmed the preferential coupling of vGPCR.15 to Gαq and the inability of vGPCR.8 to couple functionally to Gαq . Additional functional analyses measuring receptor-activated vascular endothelial growth factor promoter induction and activation of NF-κB, MAPK, and Ca2+ mobilization pathways have further characterized the signaling properties of these variants . These studies collectively demonstrate that HHV-8 vGPCR contains specific determinants of G protein selectivity that significantly impact its downstream signaling and biological functions.

What experimental approaches can be used to generate and analyze vGPCR mutants in the context of the viral genome?

The generation of recombinant HHV-8 genomes with vGPCR mutations can be accomplished using bacterial artificial chromosome (BAC) technology . This approach involves a multi-step process beginning with the replacement of the native ORF74 with a tetracycline resistance cassette (Tetr) flanked by FRT sites . Following selection of resolved cointegrants on sucrose and isolation of tetracycline-resistant recombinants, the Tetr expression cassette can be removed by transfection of a temperature-sensitive Flp recombinase-expressing plasmid (pCP20) . Tetracycline-sensitive colonies are then selected and screened for appropriate recombination by restriction digestion and Southern blot analysis .

This strategy can be used to generate various HHV-8 bacmid genomes, including those with complete ORF74 deletion (ΔORF74), point mutations affecting G protein coupling (e.g., R322W/vGPCR.8 and M325S/vGPCR.15), or a frameshifting insertion after the first ATG codon (ORF74X) . Repaired counterparts of these mutated genomes can be generated using essentially the same strategy, replacing mutated ORFs with wild-type ORF74 . The general integrity of recombinant genomes is verified by restriction digestion, and transcription from the K14/ORF74 region can be checked by quantitative reverse transcription-PCR (RT-qPCR) analysis of bacmid-transfected cells .

Analysis of these recombinant viruses involves transfection into appropriate cell types (e.g., HEK293T cells) followed by lytic cycle induction with TPA treatment or RTA expression vector transfection . Replication competence can be assessed by qPCR determination of viral genome copy numbers in cultures post-induction . This experimental system allows for direct comparison of the replication capacities of different vGPCR variants, providing valuable insights into the functional significance of specific receptor domains and signaling pathways.

How can vGPCR depletion experiments be designed to study its role in viral replication?

Depletion of vGPCR using RNA interference provides a complementary approach to gene knockout for studying its role in viral replication . This approach involves the generation of vGPCR mRNA-specific short hairpin RNAs (shRNAs) that can be cloned into lentiviral vectors, typically co-expressing a reporter gene such as GFP for identification of transduced cells . The effectiveness of these shRNAs should first be validated in an appropriate model system, such as by measuring depletion of vGPCR-RFP fusion protein levels in transfected HEK293T cells .

For studying the effects of vGPCR depletion on virus replication in naturally infected cells, primary effusion lymphoma (PEL) cell lines such as BCBL-1 can be transduced with lentiviral vectors expressing vGPCR-directed shRNAs or a non-silencing (NS) control shRNA . Following lytic reactivation with TPA, viral production can be quantified by measuring encapsidated viral genomes released into culture media . This typically involves ultracentrifuge pelleting of virions, DNase I treatment to eliminate non-encapsidated DNA, and qPCR quantification of viral genomes . Significant reductions in virus titers in cultures expressing vGPCR-targeted shRNAs relative to control cultures would indicate a positive role for vGPCR in viral replication .

Similar depletion experiments can be performed in other relevant cell types, such as endothelial (TIME) cells infected with HHV-8 . In this system, establishment of latent infection should be confirmed by immunofluorescence staining for latency-associated nuclear antigen (LANA) before proceeding with lytic induction and virus quantification . These complementary approaches in different cell types provide robust evidence regarding the role of vGPCR in HHV-8 replication and can be combined with rescue experiments to confirm specificity of the observed effects.

What gain-of-function approaches can be used to investigate vGPCR's role in viral replication?

Gain-of-function experimental approaches provide valuable complementary evidence regarding the role of vGPCR in HHV-8 replication . These experiments typically involve overexpression of wild-type or mutant vGPCR in HHV-8 latently infected cells, followed by lytic induction and quantification of virus production . For example, vGPCR overexpression in TPA-treated HHV-8-infected TIME cultures has been shown to boost normal levels of virus production, confirming the functional significance of this receptor in enhancing viral replication .

This experimental approach allows for direct comparison of different vGPCR variants and other viral proteins . For instance, overexpression of vGPCR.8 (R322W, Gαi-specific) and vGPCR.15 (M325S, predominantly Gαq-coupled) in TIME cells has revealed that Gαi coupling is insufficient to support vGPCR-promoted HHV-8 replication, whereas Gαq-coupled vGPCR.15 enhances TPA-induced virus replication equivalently to wild-type vGPCR . In contrast, overexpression of another viral protein, vOX2, has no effect on virus production, demonstrating the specificity of vGPCR's proreplication activity .

These gain-of-function experiments are particularly valuable for investigating the signaling mechanisms underlying vGPCR's effects on viral replication . The differential activities of vGPCR variants with altered G protein coupling preferences have implicated Gαq-mediated signal transduction, which strongly activates MAPK signaling via phospholipase C, as particularly important in promoting HHV-8 replication . Combined with loss-of-function approaches such as gene knockout and RNA interference, these gain-of-function experiments provide robust evidence regarding the role and mechanism of action of vGPCR in viral replication.

How can transgenic models be used to study vGPCR's role in viral pathogenesis?

Transgenic expression of vGPCR has been used to investigate its role in viral pathogenesis, particularly in the context of Kaposi's sarcoma (KS) development . In these models, vGPCR expression induces the development of angioproliferative lesions that resemble those seen in KS . The lesions typically appear on ears, limbs, and tail, progressing from erythematous lesions to nodules and tumors within 6 months . Histologically, these lesions are composed of large numbers of spindle-shaped CD34+ cells, mirroring a key feature of KS lesions .

These transgenic models provide valuable insights into the mechanisms by which vGPCR contributes to HHV-8-associated disease pathogenesis . The receptor has been implicated in triggering angiogenic responses, consistent with its known ability to induce the production of angiogenic cytokines . This angiogenic activity is likely mediated through the activation of multiple signaling pathways, including those involving MAPK and NF-κB, which regulate the expression of cytokines, growth factors, and other mediators of angiogenesis and inflammation .

While these transgenic models focus primarily on vGPCR's role in pathogenesis rather than viral replication, they complement in vitro studies of vGPCR function and provide a more comprehensive understanding of this multifunctional viral protein . The ability of vGPCR to promote both viral replication and pathogenesis illustrates the complex interplay between these processes in the context of HHV-8 infection and associated diseases. Future studies combining aspects of these different model systems may provide further insights into how vGPCR's diverse activities contribute to the HHV-8 life cycle and disease development.

What methods can be used to assess G protein coupling specificity of vGPCR variants?

Multiple complementary approaches can be used to assess the G protein coupling specificity of vGPCR variants . GTPγS incorporation assays provide a direct measure of functional coupling to specific G proteins . This technique measures the exchange of GDP for the non-hydrolyzable GTP analog GTPγS, which occurs upon G protein activation by a coupled receptor . Using this approach, researchers have demonstrated preferential coupling of vGPCR.15 to Gαq and an inability of vGPCR.8 to couple functionally to Gαq .

Physical association between receptors and G proteins can be assessed through co-immunoprecipitation studies . Interestingly, these studies have shown that both vGPCR.8 and vGPCR.15 variants, as well as wild-type vGPCR and a C-tail deletion version, are equally able to associate physically with Gαq, despite their differences in functional coupling . This suggests that receptor-G protein interactions involve distinct domains mediating physical association versus functional coupling .

Downstream signaling pathways activated by different vGPCR variants can be analyzed using a variety of functional assays . These include measurement of receptor-activated vascular endothelial growth factor promoter induction, NF-κB activation, MAPK phosphorylation, and calcium mobilization . The vGPCR.8 variant (Gαi-specific) signals predominantly via phosphatidylinositol 3-kinase/NF-κB pathways, while the vGPCR.15 variant (coupling preferentially with Gαq) activates protein kinase C/MAPK pathways . By correlating these signaling activities with the G protein coupling preferences of different vGPCR variants, researchers can gain insights into the specific pathways mediating various biological effects of the receptor.

How do you interpret differences in replication efficiency between wild-type and mutant vGPCR viruses?

Differences in replication efficiency between wild-type and mutant vGPCR viruses provide valuable insights into the role of specific vGPCR domains and signaling pathways in viral replication . When interpreting these differences, it is essential to consider multiple factors, including the nature of the mutation, the specific pathways affected, and the potential for compensatory mechanisms . The reversion to wild-type phenotype for repaired genomes serves as a critical control, confirming that observed phenotypes are due to the intended mutation rather than coincidental alterations elsewhere in the genome .

Complete deletion or functional inactivation of vGPCR (as in ΔORF74 or ORF74X genomes) results in significant decreases in viral genome copy numbers following lytic induction, indicating a positive role for vGPCR in HHV-8 productive replication . This is consistent with findings from vGPCR depletion experiments in PEL and TIME cells, which also show reduced virus production . Together, these results provide strong evidence that vGPCR deficiency, rather than ORF74 locus disruption, leads to impaired replication .

More subtle mutations affecting G protein coupling preference reveal the importance of specific signaling pathways . HHV-8 genomes encoding vGPCR.8 (Gαi-specific) show impaired virus production, whereas those specifying vGPCR.15 (predominantly Gαq-coupled) are essentially unaffected . This suggests that signaling via Gαq activation and targeted MAPK pathways is particularly important for vGPCR's proreplication activity, while NF-κB signaling may be less critical in this context . These interpretations are further supported by gain-of-function experiments showing that Gαi coupling is insufficient to support vGPCR-promoted HHV-8 replication, whereas Gαq-coupled vGPCR.15 enhances virus replication equivalently to wild-type vGPCR .

How can conflicting results regarding vGPCR's role in viral replication be reconciled?

Conflicting results regarding vGPCR's role in viral replication may arise from differences in experimental systems, timing and levels of vGPCR expression, cell types used, or specific conditions of the experiments . For example, one study using engineered HHV-8 latently infected PEL cells conditionally expressing vGPCR found that induced receptor expression led to cell cycle arrest and reduced viral lytic gene expression in TPA/butyrate-reactivated cultures . While cell cycle arrest is compatible with productive replication, the reduced lytic gene expression seems counterintuitive given vGPCR's proreplication activity demonstrated in other systems .

This apparent contradiction may be reconciled by considering the timing and levels of vGPCR expression in different experimental settings . In the conditional expression system, high levels of vGPCR expression prior to chemical induction may have different effects than the regulated expression that occurs during normal lytic replication . Additionally, vGPCR may have different functions depending on the specific phase of the viral replication cycle and the cellular context . The receptor might promote or inhibit particular aspects of viral replication depending on the precise timing and level of its expression .

Another consideration is that vGPCR may contribute to viral replication through multiple mechanisms, which could have different relative importance in different experimental systems . These mechanisms might include direct activation of viral lytic gene expression, effects on cell cycle state and/or prosurvival signaling, and indirect mechanisms involving the induction of cytokines or other signal transducers . The predominant mechanism in a given system could depend on cell type, viral strain, and specific experimental conditions . Future studies with cell types relevant to HHV-8 replication, such as endothelial and B cells, under various conditions may help resolve these apparent contradictions and provide a more comprehensive understanding of vGPCR's role in viral replication .

What are the implications of vGPCR's dual roles in viral replication and pathogenesis?

The dual roles of vGPCR in promoting both viral replication and pathogenesis have important implications for understanding HHV-8 biology and developing therapeutic strategies . From an evolutionary perspective, vGPCR's proreplication function provides a clear selective advantage for the virus, explaining its conservation among gammaherpesviruses . The pathogenic effects, including angiogenesis and transformation, might be considered "side effects" of signaling pathways that primarily evolved to enhance viral replication .

The cell type-specific effects of vGPCR signaling highlight the importance of studying its function in physiologically relevant contexts . While most current data come from cell culture systems, future studies in primary cell types targeted by HHV-8 during natural infection will be crucial for translating these findings to clinical applications . Understanding the interplay between viral replication and pathogenesis in specific anatomical and cellular contexts may provide insights into the factors that determine disease development and progression in HHV-8-infected individuals . This knowledge could ultimately lead to new approaches for preventing or treating HHV-8-associated diseases through targeted modulation of vGPCR signaling or its downstream effectors .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.