Recombinant Human HERV-H LTR-associating protein 2 (HHLA2)

Shipped with Ice Packs
In Stock

Description

Immunological Roles and Mechanisms

HHLA2 interacts with TMIGD2 (T-cell immunoglobulin and mucin domain 2) to modulate T-cell activation:

Key Functions

  • T-Cell Costimulation: Binds TMIGD2 to enhance T-cell proliferation and cytokine production (e.g., IFN-γ, IL-2) via AKT-dependent signaling .

  • Immunosuppression: Soluble HHLA2 inhibits CD4⁺/CD8⁺ T-cell activation, suppressing IL-5, IL-10, TNF-α, and IL-17A .

  • PD-L1 Synergy: Co-expression with PD-L1 in tumors may amplify immune evasion .

Binding Affinity and Inhibition

ApplicationResultSource
TMIGD2 BindingEC₅₀: 0.8–4.8 µg/mL (His-tag variant)
T-Cell InhibitionED₅₀: 0.075–0.75 µg/mL (Fc chimera)
SDS-PAGE Bands55–65 kDa (reducing/non-reducing conditions)

Clinical Significance in Cancer

HHLA2 overexpression is linked to tumor progression and prognosis, particularly in cervical adenocarcinoma (AC):

Key Findings:

Research Applications

Recombinant HHLA2 is utilized in:

  • Immune Checkpoint Studies: Blocking HHLA2-TMIGD2 interaction to enhance antitumor immunity .

  • Biomarker Development: Assessing HHLA2 expression in tumor microenvironments for prognostic stratification .

  • Structural Biology: Crystallization or binding assays to map TMIGD2 or KIR3DL3 interactions .

Challenges and Future Directions

  • Therapeutic Targeting: KIR3DL3-HHLA2 inhibition shows promise in cancers like lung, gastric, and renal tumors .

  • Expression Heterogeneity: Variable HHLA2 expression across tumor types necessitates subtype-specific studies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HHLA2; HERV-H LTR-associating protein 2; Human endogenous retrovirus-H long terminal repeat-associating protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-414
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
HHLA2
Target Protein Sequence
IFPLAFFIYVPMNEQIVIGRLDEDIILPSSFERGSEVVIHWKYQDSYKVHSYYKGSDHLE SQDPRYANRTSLFYNEIQNGNASLFFRRVSLLDEGIYTCYVGTAIQVITNKVVLKVGVFL TPVMKYEKRNTNSFLICSVLSVYPRPIITWKMDNTPISENNMEETGSLDSFSINSPLNIT GSNSSYECTIENSLLKQTWTGRWTMKDGLHKMQSEHVSLSCQPVNDYFSPNQDFKVTWSR MKSGTFSVLAYYLSSSQNTIINESRFSWNKELINQSDFSMNLMDLNLSDSGEYLCNISSD EYTLLTIHTVHVEPSQETASHNKGLWILVPSAILAAFLLIWSVKCCRAQLEARRSRHPAD GAQQERCCVPPGERCPSAPDNGEENVPLSGKV
Uniprot No.

Target Background

Function
HHLA2, through interaction with TMIGD2, co-stimulates T cells during TCR-mediated activation. This enhances T-cell proliferation and cytokine production via an AKT-dependent signaling cascade.
Gene References Into Functions
  1. HHLA2 expression was assessed in primary and metastatic osteosarcoma samples. Metastatic samples showed near-universal HHLA2 expression, significantly higher than in primary samples without metastasis. PMID: 27531281
  2. While absent in most normal lung tissue, HHLA2 was expressed in 66% of non-small cell lung cancers (NSCLC) across subtypes. EGFR-mutated NSCLC showed significantly higher HHLA2 expression. HHLA2 expression is thus prevalent in NSCLC and correlates with EGFR mutations and high tumor-infiltrating lymphocytes (TILs) in lung adenocarcinoma. PMID: 27553831
  3. Low B7-H5 expression is associated with pancreatic adenocarcinomas. PMID: 25519928
  4. The HHLA2 pathway represents a novel immunosuppressive mechanism within the tumor microenvironment. PMID: 25549724
  5. B7 homologue 5 (B7-H5) was identified as a specific ligand for CD28H. PMID: 23784006
  6. HHLA2 protein localization studies demonstrated predominant cell membrane expression with cytoplasmic presence. PMID: 23716685
Database Links

HGNC: 4905

OMIM: 604371

KEGG: hsa:11148

STRING: 9606.ENSP00000350402

UniGene: Hs.225968

Subcellular Location
Membrane; Single-pass type I membrane protein.
Tissue Specificity
Expressed at high levels in colon, kidney, testis, lung and pancreas, and at lower levels in small intestine, liver and skeletal muscle. In immune cells, highly expressed in B-cells, dendritic cells and macrophages. Not detected in T-cells.

Q&A

What is HHLA2 and what protein family does it belong to?

HHLA2 (HERV-H LTR-associating protein 2) is a member of the B7 family of immune checkpoint proteins that shares 10-18% amino acid identity and 23-33% similarity to other human B7 proteins. Phylogenetically, it forms a subfamily with B7x and B7-H3 within the B7 family . Unlike other members of the B7 and CD28 families, HHLA2 is uniquely expressed in humans but not in mice, making it an interesting target for human-specific immune regulation research . HHLA2 functions primarily as a negative regulator of T cells, inhibiting both CD4 and CD8 T-cell proliferation and cytokine production when T-cell receptor signaling is present .

What is the expression pattern of HHLA2 in normal and cancerous tissues?

HHLA2 is constitutively expressed on the surface of human monocytes and can be induced on B cells following stimulation with lipopolysaccharide (LPS) and interferon-gamma (IFN-γ) . In cancerous contexts, HHLA2 is significantly overexpressed compared to normal tissues. For example, in hepatocellular carcinoma (HCC), HHLA2 expression was found to be significantly higher in 66.67% of tumor tissues compared to matching peritumoral tissues as determined by RT-PCR . Similar patterns have been observed in clear cell renal cell carcinoma (ccRCC) and other cancers, where HHLA2 is more prevalently expressed than other immune checkpoint molecules like PD-L1 . Immunohistochemistry (IHC) staining of tissue microarrays from 189 HCC patients confirmed higher levels of HHLA2 in malignant tissues, with 70.4% of cancerous tissues scoring higher than matched non-cancerous tissues .

How does HHLA2 inhibit T-cell function mechanistically?

HHLA2 operates as a negative regulator of human T cells through binding to a putative receptor that is constitutively expressed on both resting and activated CD4 and CD8 T cells, as well as on antigen-presenting cells . When HHLA2 engages with this receptor in the presence of T-cell receptor (TCR) signaling, it suppresses T-cell proliferation. Additionally, HHLA2 significantly reduces the production of multiple cytokines by T cells, including IFN-γ, TNF-α, IL-5, IL-10, IL-13, IL-17A, and IL-22 . This broad inhibition of cytokine production suggests that HHLA2 may interfere with multiple signaling pathways downstream of TCR activation. Current research indicates that HHLA2 may contribute to an immunosuppressive tumor microenvironment by promoting T-cell exhaustion, particularly evidenced by increased infiltration of PD-1+ exhausted CD8+ T cells in HHLA2-high tumors .

What methodologies are commonly used to detect HHLA2 expression in tissues?

Researchers typically employ multiple complementary techniques to detect and quantify HHLA2 expression:

  • Immunohistochemistry (IHC): The most common method for detecting HHLA2 protein in tissue samples, allowing visualization of expression patterns and subcellular localization. Expression is typically quantified using H-scores based on staining intensity and percentage of positive cells .

  • Reverse Transcription PCR (RT-PCR): Used to measure HHLA2 mRNA expression levels in tissues and cell lines .

  • Multiple Immunofluorescence (mIF): Enables simultaneous detection of HHLA2 and other immune markers (e.g., CD8, PD-1) to study co-expression patterns and cellular interactions within the tumor microenvironment .

  • RNA Sequencing: Provides comprehensive gene expression profiling, allowing for correlation of HHLA2 expression with other genes and pathways .

When performing these analyses, appropriate controls and validation with multiple techniques are essential for reliable results, as expression patterns may vary across different cancer types and stages.

How does HHLA2 expression correlate with tumor immune microenvironment characteristics?

Multiple algorithms confirm that HHLA2 expression positively correlates with immune infiltrates, including exhausted T cells . Multiplex immunofluorescence validation demonstrated that high HHLA2 expression was associated with increased infiltration of CD8+ T cells (r=0.230, P=0.033) and exhausted PD-1+ T cells (r=0.309, P=0.004) . The proportion of non-exhausted T cells in HHLA2-high tumors was significantly reduced, with PD-1 single-positive cells being the most common . These findings suggest that HHLA2 may promote an immunosuppressive environment characterized by T-cell exhaustion despite increased infiltration.

What is the prognostic value of HHLA2 expression in different cancer types?

HHLA2 expression has emerged as a significant independent prognostic biomarker across multiple cancer types:

A significant advancement in prognostic assessment involves integrating HHLA2 expression with other clinical parameters. Researchers have developed nomograms incorporating HHLA2 H-scores with multiple clinicopathological parameters, providing semi-quantitative methods for evaluating patient outcomes . Calibration curves have demonstrated that these nomograms accurately predict 3- and 5-year OS and TTR .

What experimental approaches can be used to study HHLA2's functional mechanisms?

To investigate HHLA2's functional mechanisms, researchers should consider these methodological approaches:

  • Gene Knockdown/Knockout Studies:

    • CRISPR-Cas9 gene editing to create HHLA2-knockout cell lines

    • siRNA or shRNA for transient or stable knockdown

    • Compare phenotypic changes in proliferation, migration, and invasion capacities

  • Overexpression Models:

    • Transfection with HHLA2-expressing vectors

    • Creation of stable cell lines with inducible HHLA2 expression

    • Xenograft models with differential HHLA2 expression

  • Co-culture Systems:

    • Primary T cells or T-cell lines cultured with HHLA2-expressing tumor cells

    • Measurement of T-cell proliferation using CFSE dilution assays

    • Assessment of cytokine production using multiplex cytokine arrays or ELISA

    • Analysis of T-cell exhaustion markers via flow cytometry

  • Pathway Analysis:

    • RNA-Seq or proteomics to identify downstream effectors

    • Phosphorylation studies to examine signaling cascade activation

    • Chromatin immunoprecipitation (ChIP) to identify transcriptional targets

  • In vivo Models:

    • Humanized mouse models (necessary since HHLA2 is not expressed in mice)

    • Patient-derived xenografts with varying HHLA2 expression levels

    • Combination therapy studies with existing immunotherapeutics

When designing these experiments, researchers should be mindful that HHLA2 is human-specific and not expressed in mice , necessitating humanized models for in vivo studies.

How can HHLA2 expression be regulated at genetic and epigenetic levels?

Current research suggests multiple regulatory mechanisms controlling HHLA2 expression:

  • Epigenetic Regulation: Promoter hypomethylation appears to play a significant role in high HHLA2 expression in cancer. Contrary to many tumor suppressor genes that undergo hypermethylation-mediated silencing, genomic alteration analyses revealed that promoter hypermethylation of HHLA2 may be associated with its low expression . In hepatocellular carcinoma, HHLA2 expression was regulated by promoter hypomethylation, suggesting epigenetic mechanisms drive its overexpression .

  • Transcriptional Regulation: While specific transcription factors regulating HHLA2 have not been fully characterized in the provided sources, the inducibility of HHLA2 on B cells after stimulation with LPS and IFN-γ suggests inflammatory signaling pathways may control its expression .

  • Post-translational Modifications: Research on post-translational modifications affecting HHLA2 protein stability or function remains limited and represents an important area for future investigation.

  • Copy Number Variations: Analysis of TCGA data suggests potential roles for genomic alterations in regulating HHLA2 expression, though the specific impact of copy number variations requires further investigation .

To study these regulatory mechanisms, researchers could employ:

  • Bisulfite sequencing to analyze promoter methylation patterns

  • Luciferase reporter assays to identify functional promoter elements

  • ChIP-seq to identify transcription factor binding sites

  • Treatment with DNA methyltransferase inhibitors or histone deacetylase inhibitors to assess epigenetic regulation

What are the implications of HHLA2 for immunotherapy response prediction?

HHLA2 shows promising potential as a biomarker for predicting immunotherapy responses and as a therapeutic target itself:

What are the best practices for producing and validating recombinant HHLA2 protein?

Producing high-quality recombinant HHLA2 protein requires careful planning and validation:

  • Expression Systems Selection:

    • Mammalian expression systems (HEK293, CHO cells) are preferred for human proteins requiring proper folding and post-translational modifications

    • Insect cell systems (Sf9, High Five) offer intermediate complexity for glycosylated proteins

    • Bacterial systems (E. coli) may be suitable for protein fragments or domains but typically not for full-length glycoproteins

  • Construct Design Considerations:

    • Include appropriate tags (His, FLAG, Fc) for purification and detection

    • Consider including cleavable tags to remove them post-purification

    • For functional studies, determine whether to express the full extracellular domain or specific functional domains

    • Codon optimization for the chosen expression system

  • Purification Strategy:

    • Multi-step purification combining affinity chromatography with size exclusion or ion exchange

    • Removal of endotoxin for functional immunological assays

    • Buffer optimization for protein stability

  • Validation Methods:

    • SDS-PAGE and Western blotting to confirm size and immunoreactivity

    • Mass spectrometry to verify protein identity and modifications

    • Circular dichroism to assess secondary structure

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to confirm proper oligomeric state

    • Functional binding assays to verify interaction with its receptor(s)

    • Endotoxin testing before use in immune cell assays

  • Activity Assessment:

    • T-cell proliferation assays to confirm inhibitory function

    • Cytokine production measurement from co-cultures

    • Comparison with commercially available standards when possible

These methodological considerations ensure that the recombinant protein authentically represents native HHLA2 for reliable experimental outcomes.

How can researchers effectively analyze HHLA2 in clinical samples?

Comprehensive analysis of HHLA2 in clinical samples requires an integrated approach:

Researchers have successfully employed these methods to demonstrate that high HHLA2 expression serves as an independent prognostic biomarker for outcomes in cancer patients .

What key questions remain unanswered about HHLA2 biology?

Despite significant progress in HHLA2 research, several crucial questions remain unanswered:

  • Receptor Identification and Signaling: While HHLA2 binds to a putative receptor on T cells and antigen-presenting cells, the complete identification and characterization of this receptor(s) remains incomplete . Elucidating the signaling pathways activated downstream of HHLA2-receptor interaction would provide valuable insights into its inhibitory mechanisms.

  • Regulatory Mechanisms: The comprehensive regulatory network controlling HHLA2 expression in normal and pathological conditions remains underdefined. While promoter hypomethylation appears to drive overexpression in some cancers , other transcriptional, post-transcriptional, and post-translational regulatory mechanisms warrant investigation.

  • T-cell Exhaustion Mechanisms: Although HHLA2 expression correlates with increased exhausted CD8+ T cells, the precise mechanisms through which HHLA2 contributes to T-cell exhaustion require further exploration . Understanding whether HHLA2 directly induces exhaustion or creates conditions favoring exhaustion is critical.

  • Evolutionary Significance: The human-specific expression of HHLA2 (absent in mice) raises questions about its evolutionary development and functional significance . Comparative studies across species might reveal important insights about immune checkpoint evolution.

  • Interaction with Other Immune Checkpoints: While co-expression with PD-L1 has been observed , the potential synergistic or antagonistic interactions between HHLA2 and other immune checkpoint molecules in regulating immune responses remains to be fully characterized.

  • Therapeutic Targeting Strategies: Optimal approaches for therapeutic targeting of the HHLA2 pathway, including antibody development considerations, combination strategies, and potential resistance mechanisms require further investigation.

Addressing these questions would significantly advance our understanding of HHLA2 biology and its therapeutic potential.

How should researchers design clinical studies targeting HHLA2?

Future clinical studies targeting HHLA2 should consider these methodological approaches:

These design considerations would help maximize the potential for successful clinical development of HHLA2-targeted therapies while advancing our understanding of its role in anti-tumor immunity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.