Recombinant Human HERV-K_1q23.3 provirus ancestral Env polyprotein

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ERVK-18; Endogenous retrovirus group K member 18 Env polyprotein; Envelope polyprotein; HERV-K(C1a envelope protein; HERV-K110 envelope protein; HERV-K18 envelope protein; HERV-K18 superantigen; HERV-K_1q23.3 provirus ancestral Env polyprotein; IDDMK1,2 22 envelope protein; IDDMK1,2 22 superantigen
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
355-560
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
ERVK-18
Target Protein Sequence
FIFTLIAVIMGLIAVTATAAVAGVALHSSVQSVNFVNYWQKNSTRLWNSQSSIDQKLASQ INDLRQTVIWMGDRLMTLEHHFQLQCDWNTSDFCITPQIYNESEHHWDMVRRHLQGREDN LTLDISKLKEQIFEASKAHLNLVPGTEAIAGVADGLANLNPVTWIKTIRSTMIINLILIV VCLFCLLLVCRCTQQLRRDSDIENGP
Uniprot No.

Target Background

Function

Retroviral envelope proteins mediate receptor recognition and membrane fusion during early infection. Endogenous envelope proteins may retain, lose, or modify their original function during evolution. This envelope protein exhibits superantigenic properties. The surface unit (SU) mediates receptor recognition, while the transmembrane unit (TM) anchors the envelope heterodimer to the viral membrane via a transmembrane domain. A second hydrophobic domain, the fusion peptide, mediates fusion between the viral and target cell membranes.

Database Links

HGNC: 39025

Protein Families
Beta type-B retroviral envelope protein family, HERV class-II K(HML-2) env subfamily
Subcellular Location
[Transmembrane protein]: Cell membrane; Single-pass type I membrane protein.; [Surface protein]: Cell membrane; Peripheral membrane protein.; [Endogenous retrovirus group K member 18 Env polyprotein]: Virion.
Tissue Specificity
Expressed at higher level in the thymus. Expressed at lower level in peripheral blood lymphocytes.

Q&A

What is the genomic structure of HERV-K_1q23.3 provirus and its Env polyprotein?

The HERV-K_1q23.3 provirus represents one of the human-specific HERV-K (HML2) elements located on chromosome 1 at position q23.3. Like other HERV-K elements, it belongs to a family that constitutes part of the approximately 8% of the human genome composed of retroviral sequences . The HERV-K family is considered the most complete of the human endogenous retroviruses, containing transcriptionally active gag, pol, and env genes . The Env polyprotein is encoded by the env gene and represents a key structural component that mediates viral entry into host cells.

The full-length HERV-K Env protein typically has a molecular mass of 80-90 kDa and contains both surface (SU) and transmembrane (TM) domains, connected by a furin cleavage site. The protein includes signal peptides that direct its synthesis to the endoplasmic reticulum and several N-glycosylation sites that are important for proper folding and function .

How is recombinant HERV-K Env polyprotein expressed in laboratory settings?

Expression of recombinant HERV-K Env polyprotein can be achieved through various vector systems. Research has demonstrated successful expression using both baculovirus constructs in insect cells and mammalian expression vectors in human cell lines.

In one methodological approach, researchers constructed a series of recombinant HERV-K env expression vectors for both insect cell infection and mammalian cell transfection experiments. Six baculovirus constructs bearing full-length or truncated HERV-K env sequences, with or without homologous or heterologous signal peptides, were used for infections of insect cells. All recombinant baculoviruses yielded ENV proteins with the expected molecular masses. Notably, the full-length 80-90 kDa HERV-K ENV protein, including the cORF leader sequence, was successfully glycosylated in insect cells .

For mammalian cell expression, researchers typically use strong promoters such as CMV to drive expression, as evidenced in experiments reconstructing ancestral HERV-K elements .

What methods are used to detect HERV-K expression in biological samples?

Detection of HERV-K expression in biological samples typically relies on molecular techniques targeting either RNA transcripts or protein products:

RNA Detection Methods:

  • Semiquantitative RT-PCR: RNA is isolated from samples, reverse-transcribed to cDNA, and amplified using primers specific to HERV-K sequences. Expression levels are normalized to housekeeping genes like GAPDH .

  • Real-time quantitative PCR (RT-qPCR): Provides more precise quantification of HERV-K transcripts.

  • RNA sequencing (RNA-seq): Allows for comprehensive analysis of HERV-K transcription patterns.

A detailed PCR approach involves using primer sets that can distinguish between full-length HERV-K transcripts and splice variants. For example, researchers have used combinations of primers targeting different regions of the HERV-K genome to identify specific transcripts:

  • Primers targeting gag-pol regions detect full-length transcripts

  • Primers spanning splice junctions detect env splice variants

  • Specific primer combinations can detect the double-spliced rec and 1.5 kb transcripts

Protein Detection Methods:

  • Western blotting: Using antibodies against HERV-K Env proteins

  • Immunohistochemistry: For detecting HERV-K proteins in tissue samples

  • Flow cytometry: For analyzing HERV-K expression at the cellular level

What is known about the evolutionary history of HERV-K_1q23.3 and related proviruses?

HERV-K elements entered the human genome through infection of germline cells by exogenous retroviruses millions of years ago and have since been inherited in a Mendelian fashion . The HERV-K (HML2) group, to which HERV-K_1q23.3 belongs, represents one of the most recently integrated and best-preserved HERV families in humans.

Evolutionary analyses suggest that HERV-K (HML2) elements have undergone several waves of amplification during primate evolution, with the most recent expansions occurring after the divergence of humans and chimpanzees. This has resulted in human-specific insertional polymorphisms, with some HERV-K loci present only in certain human populations .

Through computational approaches, researchers have reconstructed ancestral sequences that represent the likely progenitors of modern HERV-K elements. The most notable example is "Phoenix," a consensus sequence derived from multiple HERV-K (HML2) proviruses that, when synthetically reconstructed, produces functional viral particles capable of infecting human cells .

How are ancestral HERV-K elements reconstructed, and what insights does this provide about HERV-K_1q23.3?

Reconstruction of ancestral HERV-K elements involves sophisticated computational and experimental approaches:

Computational Reconstruction:

  • Sequence alignment of multiple HERV-K loci from the human genome

  • Identification of the most conserved sequences and generation of consensus sequences

  • Phylogenetic analysis to determine evolutionary relationships between different HERV-K elements

  • In silico reconstruction of putative ancestral sequences

Experimental Validation:

  • Synthesis of the reconstructed sequence

  • Insertion into expression vectors

  • Transfection into mammalian cells

  • Assessment of viral particle production and infectivity

The most successful example of this approach is the Phoenix element, which was derived in silico as a consensus sequence from multiple HERV-K (HML2) loci. When constructed experimentally, Phoenix produced viral particles with all the structural and functional properties of a bona fide retrovirus, could infect mammalian cells (including human cells), and integrated with the exact signature pattern found in endogenous HERV-K progeny .

Similar approaches could be applied to specifically study the ancestral form of HERV-K_1q23.3, which might reveal unique features of this particular provirus and its Env polyprotein compared to other HERV-K elements.

What evidence suggests HERV-K elements can recombine to generate functional retroviruses?

Research has provided compelling evidence that recombination between HERV-K loci can generate functional retroviral elements:

In experimental settings, researchers constructed chimeric HERV-K elements using fragments from different human HERV-K (HML2) proviruses. Specifically, they created a chimera using the 5' portion from HERV-K109, the 3' end from HERV-K115, and replaced the U3 region of the 5' LTR with a CMV promoter. This chimeric construct showed virion-associated reverse transcriptase (RT) activity in the supernatant when transfected into human 293T cells .

This demonstrates that human cells still retain the potential to produce infectious retroviruses through recombination events between existing HERV-K loci. Such recombination could occur either through a three-fragment recombination event or, more likely, via a single recombination event between two HERV-K copies with complementation in trans by an intact envelope protein from a third source .

What role might HERV-K_1q23.3 Env polyprotein play in human health and disease?

HERV-K elements, including their Env polyproteins, have been implicated in various human health conditions:

Cancer:
HERV-K expression has been detected in multiple human cancers, including teratocarcinomas and melanomas . The Env polyprotein may contribute to tumorigenesis through various mechanisms:

  • Immunomodulation and evasion of immune surveillance

  • Promotion of cell proliferation and resistance to apoptosis

  • Enhancement of cell migration and invasion

  • Induction of genomic instability

Notably, splice variants of the env gene (rec, 1.5 kb transcript, and Np9) have been specifically suggested to possess tumorigenic properties .

Neurodegenerative Diseases:
HERV-K elements have been associated with neurodegenerative conditions such as amyotrophic lateral sclerosis (ALS) and multiple sclerosis (MS) .

Autoimmune Disorders:
HERV-K Env proteins may trigger autoimmune responses by molecular mimicry or by acting as superantigens.

Normal Physiology:
Some HERV Env proteins have been co-opted for beneficial functions in human physiology, most notably in placental development where their fusogenic properties contribute to the formation of the syncytiotrophoblast .

What experimental approaches can differentiate between pathogenic effects and epiphenomena when studying HERV-K?

Determining whether HERV-K expression is causally related to disease or merely a consequence of cellular dysregulation remains challenging. Several experimental approaches can help distinguish between these possibilities:

Gain and Loss of Function Studies:

  • Overexpression of HERV-K genes in normal cells to assess oncogenic potential

  • siRNA or CRISPR-mediated knockdown of HERV-K expression in disease models

  • Use of specific inhibitors targeting HERV-K proteins or their signaling pathways

Temporal Association Studies:

  • Analysis of HERV-K expression during different stages of disease progression

  • Longitudinal studies correlating HERV-K levels with disease outcomes

Mechanistic Studies:

  • Identification of cellular pathways affected by HERV-K proteins

  • Characterization of protein-protein interactions involving HERV-K products

  • Analysis of genomic integration sites and their proximity to oncogenes

Animal Models:

  • Generation of transgenic animals expressing human HERV-K elements

  • Xenograft models with HERV-K-expressing human cells

Clinical Correlation:

  • Comparison of HERV-K expression patterns between affected and unaffected tissues

  • Association studies between HERV-K polymorphisms and disease susceptibility

A comprehensive approach combining these methods is likely to provide the most definitive evidence regarding the role of HERV-K in human disease .

How can post-translational modifications of HERV-K Env polyprotein be studied and what is their functional significance?

Post-translational modifications (PTMs) of HERV-K Env polyprotein significantly influence its structure, function, and immunogenic properties. Several approaches can be employed to study these modifications:

Analytical Methods for PTM Identification:

  • Mass spectrometry (MS) to identify specific modifications and their locations

  • Western blotting with modification-specific antibodies

  • Lectin affinity chromatography for glycosylation analysis

  • Phospho-specific antibodies for phosphorylation detection

Functional Analysis of PTMs:

  • Site-directed mutagenesis to remove specific modification sites

  • Expression of mutant proteins in relevant cell systems

  • Assessment of protein stability, trafficking, and function

  • Evaluation of protein-protein interactions

Research has shown that glycosylation plays a crucial role in HERV-K Env function. For example, the full-length 80-90 kDa HERV-K ENV protein including the cORF leader sequence was successfully glycosylated when expressed in insect cells using recombinant baculoviruses .

PTMs that may be particularly relevant to HERV-K Env function include:

  • N-glycosylation: Affects protein folding, stability, and immune recognition

  • Proteolytic cleavage: The Env precursor is typically cleaved into surface (SU) and transmembrane (TM) subunits

  • Palmitoylation: May influence membrane association and fusion activity

  • Phosphorylation: Could regulate protein interactions and signaling properties

Understanding these modifications is essential for comprehending the functional capabilities of both ancestral and modern HERV-K Env proteins.

What expression systems are most effective for producing functional recombinant HERV-K Env polyprotein?

Several expression systems have been used to produce recombinant HERV-K Env polyprotein, each with distinct advantages and limitations:

Baculovirus Expression System:

  • Advantages: High expression levels, capability for complex post-translational modifications

  • Applications: Successfully used to express full-length and truncated HERV-K Env proteins

  • Findings: All recombinant baculoviruses yielded ENV proteins with expected molecular masses; the full-length 80-90 kDa HERV-K ENV protein with cORF leader sequence was properly glycosylated

Mammalian Expression Systems:

  • Advantages: Native-like post-translational modifications, proper protein folding

  • Applications: Used in studies of ancestral HERV-K elements like Phoenix

  • Findings: Expression in human 293T cells under CMV promoter control produced functional viral particles

Bacterial Expression Systems:

  • Advantages: High yield, simplicity, low cost

  • Limitations: Lack of post-translational modifications, potential for improper folding

  • Applications: Useful for producing protein fragments for structural studies or antibody generation

Cell-Free Expression Systems:

  • Advantages: Rapid production, avoidance of cell toxicity

  • Applications: Useful for initial characterization studies

For functional studies of HERV-K Env polyprotein, mammalian expression systems generally provide the most physiologically relevant results, particularly when investigating properties like fusogenic activity, receptor binding, or immunomodulatory effects.

What bioinformatic tools and databases are most valuable for HERV-K research?

Researchers studying HERV-K elements, including HERV-K_1q23.3, benefit from various specialized bioinformatic tools and databases:

Genomic Databases:

  • UCSC Genome Browser - Provides detailed genomic context of HERV-K elements

  • Ensembl Genome Browser - Offers comparative genomics capabilities

  • NCBI RetroTector - Specialized in retroviral sequence identification

  • HERVd (Human Endogenous Retrovirus Database) - Focused on HERV sequences

Sequence Analysis Tools:

  • RepeatMasker - Identifies repetitive elements including HERVs

  • HMMER - Useful for profile hidden Markov model analysis of retroviral proteins

  • MEGA (Molecular Evolutionary Genetics Analysis) - For phylogenetic analysis

  • ReTe (Retrovirus integration site analysis) - Specialized in retroviral integration site analysis

Structural Prediction Tools:

  • AlphaFold/RoseTTAFold - For protein structure prediction

  • PyMOL/UCSF Chimera - For visualization and analysis of protein structures

  • NetNGlyc/NetOGlyc - For prediction of glycosylation sites

Transcriptome Analysis Tools:

  • SalmonTE - Specialized tool for quantifying transposable element expression

  • TEtranscripts - Tool for analyzing transposable element expression from RNA-seq data

Effective HERV-K research typically requires integration of multiple bioinformatic approaches, combining genomic, transcriptomic, and proteomic analyses to gain comprehensive insights into the biology of these complex genetic elements.

How can CRISPR-Cas9 technology be applied to study HERV-K function?

CRISPR-Cas9 technology offers powerful approaches for investigating HERV-K function, including specific elements like HERV-K_1q23.3:

Genomic Modification Strategies:

  • Complete Provirus Deletion:

    • Design guide RNAs targeting LTR sequences flanking the provirus

    • Delete entire HERV-K elements to assess phenotypic consequences

    • Enables clean assessment of provirus function in cellular context

  • Targeted Gene Inactivation:

    • Introduce premature stop codons in specific HERV-K genes (gag, pol, env)

    • Create frameshift mutations to disrupt protein expression

    • Allows assessment of individual gene contributions

  • Promoter Modification:

    • Target LTR promoter elements to modulate HERV-K expression

    • Introduce specific mutations in transcription factor binding sites

    • Useful for studying regulation of HERV-K expression

  • Epigenetic Editing:

    • Couple catalytically inactive Cas9 (dCas9) with epigenetic modifiers

    • Target DNA methyltransferases or histone modifiers to HERV-K regulatory regions

    • Enables manipulation of epigenetic regulation without altering sequence

Functional Screening Approaches:

  • CRISPR Activation (CRISPRa):

    • Use dCas9 fused to transcriptional activators (VP64, p65, etc.)

    • Target endogenous HERV-K elements to enhance expression

    • Assess consequences of HERV-K upregulation

  • CRISPR Interference (CRISPRi):

    • Utilize dCas9-KRAB or similar repressors

    • Specifically silence HERV-K expression

    • Evaluate phenotypic effects of HERV-K suppression

  • Genome-Wide Screens:

    • Identify host factors involved in HERV-K regulation or function

    • Screen for genes affecting HERV-K expression or activity

    • Discover novel protein-protein interactions

These approaches can be particularly valuable for understanding the functional significance of HERV-K_1q23.3 and its Env polyprotein in both normal physiology and disease contexts.

What are the major technical challenges in studying ancestral HERV-K elements?

Researchers face several significant technical challenges when studying ancestral HERV-K elements like HERV-K_1q23.3:

Sequence Reconstruction Challenges:

  • Accumulated mutations over millions of years obscure original sequences

  • Multiple evolutionary pathways may have existed, complicating ancestral sequence inference

  • Potential selection bias in preserved sequences

Expression Difficulties:

  • Ancestral sequences may contain features incompatible with modern cellular machinery

  • Codon optimization may be necessary but introduces potential artifacts

  • Achieving physiologically relevant expression levels

Functional Assessment Limitations:

  • Original host cell environment cannot be perfectly replicated

  • Modern restriction factors may inhibit ancestral viral functions

  • Interspecies barriers may affect receptor interactions

Regulatory Uncertainties:

  • Original promoter strengths and transcription factor interactions are difficult to ascertain

  • Context-dependent regulation may be lost in experimental systems

  • Epigenetic modifications of ancestral elements remain largely unknown

Despite these challenges, successful reconstructions like the Phoenix element demonstrate that functional studies of ancestral HERV-K elements are possible . These studies provide valuable insights into retroviral evolution and the potential roles of HERV-K elements in human biology.

How might HERV-K research contribute to therapeutic developments?

HERV-K research, including studies on HERV-K_1q23.3 and its Env polyprotein, has significant potential for therapeutic applications:

Cancer Therapeutics:

  • HERV-K-derived antigens as targets for immunotherapy

  • Development of monoclonal antibodies against HERV-K Env proteins

  • CAR-T cell therapies targeting HERV-K epitopes expressed in tumors

  • Small molecule inhibitors of HERV-K protein functions

Diagnostic Applications:

  • HERV-K expression patterns as biomarkers for disease detection and monitoring

  • Liquid biopsy approaches based on HERV-K transcript or protein detection

  • Imaging agents targeting HERV-K proteins for disease visualization

Vaccine Development:

  • HERV-K-based vaccines for cancer immunotherapy

  • Potential for prophylactic approaches in high-risk populations

Gene Therapy Approaches:

  • HERV-K LTR elements as natural tissue-specific promoters

  • Modified HERV-K vectors for gene delivery

The Phoenix element and other reconstructed HERV-K sequences provide powerful tools to appraise the role of elements of the HERV-K family in a range of diseases where related particles and viral proteins have been detected, including human tumors such as germ-line tumors and melanomas . Understanding the biological significance of HERV-K expression in these contexts could lead to novel therapeutic strategies targeting these ancient viral elements.

What is the current consensus on whether HERV-K elements are causative agents or epiphenomena in human diseases?

The question of whether HERV-K elements are causative agents or merely epiphenomena in human diseases remains a subject of ongoing research and debate:

Evidence Supporting Causative Roles:

  • Increased HERV-K expression in multiple human cancers

  • Demonstrated oncogenic properties of some HERV-K proteins in experimental models

  • Temporal association between HERV-K activation and disease progression

  • Functional interactions between HERV-K proteins and cellular pathways implicated in disease

Evidence Supporting Epiphenomenon Hypothesis:

  • HERV-K activation often occurs in contexts of broad epigenetic dysregulation

  • Inconsistent expression patterns across patients with the same disease

  • Lack of definitive mechanistic explanations for many proposed disease associations

  • Absence of HERV-K expression in some disease contexts

The current scientific consensus generally acknowledges that HERV-K elements likely play different roles in different disease contexts. In some cases, they may directly contribute to pathogenesis, while in others, their expression may simply reflect cellular dysregulation without causal significance .

For example, in glioblastoma multiforme (GBM), research has shown that while some GBM cell lines display weak or strong expression of full-length HERV-K, splice products like rec or 1.5 kb transcripts could not be detected in most samples. Very few tissue samples from patients showed even weak expression of env mRNA. These data suggest that HERV-K splice products do not play a significant role in human malignant gliomas .

The complexity of HERV-K biology and the technical challenges in studying these elements necessitate continued research to definitively establish their roles in human health and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.