Recombinant Human HERV-K_22q11.21 provirus ancestral Env polyprotein

Shipped with Ice Packs
In Stock

Description

Overview of HERV-K and Env Polyprotein

Human Endogenous Retroviruses (HERVs) are remnants of ancient retroviral infections integrated into the germline of humans and now constitute approximately 8% of the human genome . HERV-K (HML-2) is one family of HERVs that may have replicated in human ancestors less than 1 million years ago . These viruses contain genes such as gag, pro, pol, and env, flanked by long terminal repeats (LTRs) .

  • gag: Encodes structural proteins, including capsid and nucleocapsid proteins .

  • pro: Encodes a protease and deoxyuridine triphosphate nucleotidohydrolase (dUTPase) .

  • pol: Encodes viral enzymes, such as reverse transcriptase .

  • env: Encodes the viral envelope glycoprotein responsible for receptor recognition and membrane fusion .

The Env polyprotein is crucial for the virus's ability to enter host cells. LTRs contain regulatory elements like promoters, enhancers, and polyadenylation signals that are essential for retroviral gene expression .

HERV-K_22qProvirus

HERV-K proviruses can be categorized into two subtypes based on the presence or absence of a 292 bp deletion at the pol-env boundary . Type II proviruses express the accessory Rec protein, which facilitates the transport of unspliced or partially spliced HERV-K (HML-2) mRNAs from the nucleus to the cytoplasm . Type I proviruses have a 292 bp deletion that prevents Rec protein expression but can express an alternative protein, Np9, with no known physiological function in HERV-K (HML-2) replication . A study found that HERV-K-22q11.23 and HERV-K17 were significantly expressed in androgen-responsive prostate cancer cell lines, while HERV-K-11q23.3 and HERV-K-22q.11.21 were undetectable in prostate cancer cell lines .

Recombinant Production

Recombinant versions of HERV proteins are produced for research purposes. For example, a recombinant full-length Human HERV-K_11q22.1 provirus ancestral Env polyprotein protein, His-tagged, can be expressed in E. coli . These recombinant proteins are often used to study the structure, function, and interactions of HERV proteins.

Table 1: Recombinant HERV-K Env Polyprotein Specification

CategoryDescription
Product OverviewRecombinant Full Length Human HERV-K_11q22.1 provirus ancestral Env polyprotein Protein (P61570) (466-661aa)
TagN-terminal His tag
Expression SystemExpressed in E. coli
PurityGreater than 90% as determined by SDS-PAGE

Functional Aspects and Research Findings

HERV Env proteins have been suggested to support tumorigenesis through fusogenicity and immunosuppression . Some HERV Env proteins, like suppressyn (encoded by a HERV-F provirus in locus 21q22.3), can inhibit fusogenicity in mammals . Suppressyn, a 160 amino acid polypeptide with placenta-specific expression, corresponds to the Env N-terminal portion and includes a signal peptide (SP) and a SU subunit with a premature stop codon upstream of the SU/TM cleavage site . It competes for binding to the syncytin-1 receptor and reduces its fusogenicity .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ERVK-24; Endogenous retrovirus group K member 24 Env polyprotein; Envelope polyprotein; HERV-K101 envelope protein; HERV-K_22q11.21 provirus ancestral Env polyprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
355-588
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
ERVK-24
Target Protein Sequence
FIFTLIAVIMGLIAVTATGAVAGVALHSSVQSVNFVNDWQKNSTRLWNSQSSIDQKLANQ INDLRQTVIWMGDRLMSLEHRFQLQCDWNTSDFCITPQIYNESEHHWDMVRHHLQGREDN LTLDISKLKEQIFEASKAHLNLVPGTEAIAGVADGLANLNPVTWVKTIGSTTIINLILIL VCLFCLLLVCRCTQQLRRDSDHRERAMMTMAVLSKRKGGNVGKSKRDQIVTVSV
Uniprot No.

Target Background

Function
Retroviral envelope proteins mediate receptor recognition and membrane fusion during early infection. The function of endogenous envelope proteins may be retained, lost, or altered during evolution. The surface (SU) subunit mediates receptor recognition, while the transmembrane (TM) subunit anchors the envelope heterodimer to the viral membrane via a transmembrane domain. A second hydrophobic domain, the fusion peptide, mediates fusion of the viral and target cell membranes.
Database Links

HGNC: 39038

Protein Families
Beta type-B retroviral envelope protein family, HERV class-II K(HML-2) env subfamily
Subcellular Location
[Transmembrane protein]: Cell membrane; Single-pass type I membrane protein.; [Surface protein]: Cell membrane; Peripheral membrane protein.; [Endogenous retrovirus group K member 24 Env polyprotein]: Virion.
Tissue Specificity
Expressed in teratocarcinoma cell line.

Q&A

What is HERV-K_22q11.21 and what makes it scientifically significant?

HERV-K_22q11.21 belongs to the human endogenous retrovirus K (HERV-K) family, specifically the HML-2 subgroup, which has been subject to intensive research due to its unique characteristics. The HML-2 subgroup maintains unrivaled coding competence with many proviruses containing complete or near-complete open reading frames (ORFs) for viral polyproteins, including Env polyprotein . The scientific significance of HERV-K_22q11.21 stems from several factors: it represents one of the most recently integrated HERV groups in the human genome, potentially contributing to its relatively preserved coding capacity compared to other endogenous retroviruses . Although some studies have found that HERV-K-22q11.21 expression was not detectable in certain prostate cancer cell lines, contrasting with other HERV-K proviruses like HERV-K-22q11.23 and HERV-K17, its potential role in other tissues and diseases remains an active area of investigation .

The ancestral Env polyprotein of HERV-K_22q11.21 is particularly interesting to researchers because envelope proteins of retroviruses play crucial roles in cell entry and host-virus interactions. Understanding the structure, function, and expression patterns of this protein can provide insights into both evolutionary biology and potential pathophysiological mechanisms in human diseases.

How does the HERV-K_22q11.21 Env polyprotein compare to other HERV-K envelope proteins?

The HERV-K_22q11.21 ancestral Env polyprotein shares structural similarities with other HERV-K envelope proteins but also possesses unique characteristics that distinguish it within the HERV-K family. While comprehensive comparative analyses are still emerging, researchers have noted that HERV-K Env proteins generally contain conserved domains typical of retroviral envelope proteins, including a surface (SU) domain and a transmembrane (TM) domain.

When examining expression patterns, studies have shown differential expression of various HERV-K proviruses across tissues and disease states. For instance, while HERV-K-22q11.23 and HERV-K17 show significant expression in androgen-responsive prostate cancer cell lines and correlate with PSA levels, HERV-K-22q11.21 expression was not detectable in the same prostate cancer cell lines . This suggests tissue-specific and context-dependent regulation of different HERV-K elements.

The structural and functional differences between HERV-K_22q11.21 Env and other HERV-K Env proteins have important implications for experimental design, as researchers must employ techniques that can specifically distinguish between these closely related proteins when studying their potential biological activities.

What are the optimal storage and handling conditions for recombinant HERV-K_22q11.21 Env polyprotein?

For optimal results in experimental applications, recombinant HERV-K_22q11.21 Env polyprotein requires specific storage and handling conditions to maintain structural integrity and biological activity. Based on established protocols for similar recombinant proteins, the following recommendations apply:

Storage conditions:

  • Store lyophilized protein at -20°C for long-term storage

  • For extended preservation, storage at -80°C is recommended

  • Working aliquots can be maintained at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as this can compromise protein integrity

Handling considerations:

  • Reconstitute lyophilized protein according to manufacturer's instructions, typically using sterile buffer solutions

  • Small volumes may occasionally become entrapped in the seal of the product vial during shipment and storage; briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container's cap if necessary

  • Consider sterile filtration for applications requiring high sterility

  • For applications sensitive to endotoxin contamination, low endotoxin preparations should be requested

Following these guidelines will help ensure experimental reproducibility and reliable results when working with this recombinant protein.

What experimental approaches are most effective for studying HERV-K_22q11.21 Env polyprotein expression in tissues?

When investigating HERV-K_22q11.21 Env polyprotein expression in various tissues, researchers should employ a multi-modal approach combining molecular and immunological techniques. Quantitative assessment requires careful experimental design due to the high sequence similarity between HERV-K elements and potential cross-reactivity issues.

Recommended methodological approaches include:

  • RNA expression analysis:

    • RT-qPCR with primers specific to unique regions of HERV-K_22q11.21 env gene

    • RNA-Seq analysis with specialized bioinformatic pipelines for mapping reads to repetitive elements

    • Droplet digital PCR for absolute quantification in samples with low expression levels

  • Protein detection methods:

    • Western blotting with antibodies validated for specificity against HERV-K_22q11.21 Env

    • Immunohistochemistry on tissue sections with appropriate controls

    • Flow cytometry for detecting surface expression in cell populations

  • Cellular localization studies:

    • Immunofluorescence microscopy with co-localization markers

    • Subcellular fractionation followed by Western blotting

    • Live-cell imaging with fluorescently tagged HERV-K_22q11.21 Env

Based on similar studies with other HERV-K elements, researchers should be particularly attentive to tissue-specific expression patterns. For instance, while HERV-K-22q11.21 expression was not detectable in certain prostate cancer cell lines, its expression profile may differ in other tissue types or disease conditions . Careful selection of positive and negative controls is essential when designing these experiments.

How can researchers distinguish between the biological activities of HERV-K_22q11.21 Env and other HERV-K Env proteins?

Distinguishing the specific biological activities of HERV-K_22q11.21 Env from other closely related HERV-K Env proteins presents a significant challenge that requires sophisticated experimental approaches. Researchers should consider the following methodological strategies:

  • Sequence-specific knockdown/knockout approaches:

    • Design siRNAs or shRNAs targeting unique regions of HERV-K_22q11.21 env

    • CRISPR-Cas9 targeting of proviral sequences with careful guide RNA design to ensure specificity

    • Validation of knockdown specificity by measuring expression of multiple HERV-K elements

  • Recombinant protein expression systems:

    • Expression of HERV-K_22q11.21 Env in various systems (E. coli, yeast, baculovirus, or mammalian cells) depending on experimental requirements

    • Inclusion of epitope tags to distinguish from endogenous HERV-K proteins

    • Purification to ≥85% purity as determined by SDS-PAGE for functional studies

  • Functional assays with controls:

    • Cell fusion assays to assess fusogenic properties

    • Receptor binding studies with competitive inhibition by other HERV-K Env proteins

    • Signal transduction assays to evaluate downstream pathway activation

When interpreting results, researchers should consider potential overlapping functions between different HERV-K Env proteins, as well as context-dependent activities that may vary between cell types or physiological conditions.

What are the key considerations for investigating potential associations between HERV-K_22q11.21 Env expression and disease pathogenesis?

Investigating the relationship between HERV-K_22q11.21 Env expression and disease pathogenesis requires robust epidemiological approaches combined with mechanistic studies. Researchers should address several methodological considerations:

  • Clinical sample collection and processing:

    • Standardized protocols for tissue collection and preservation

    • Matched case-control design with appropriate sample sizes

    • Comprehensive clinical data collection to account for confounding variables

  • Expression analysis in disease contexts:

    • Quantitative comparison of expression levels between diseased and healthy tissues

    • Correlation analysis with disease markers and clinical parameters

    • Longitudinal studies to assess expression changes with disease progression

  • Mechanistic investigations:

    • Cell culture models expressing HERV-K_22q11.21 Env to assess cellular effects

    • Animal models (where feasible) to evaluate in vivo consequences

    • Pathway analysis to identify molecular mechanisms of action

When designing these studies, researchers should be aware of the tissue-specific expression patterns observed with HERV-K elements. For example, while some HERV-K proviruses (HERV-K-22q11.23 and HERV-K17) show expression correlated with PSA levels in prostate cancer, HERV-K-22q11.21 expression patterns differ . This highlights the importance of comprehensive screening across multiple tissue types and disease states.

What experimental protocols are recommended for assessing immune responses to HERV-K_22q11.21 Env polyprotein?

Investigating immune responses to HERV-K_22q11.21 Env polyprotein requires specialized immunological techniques that can detect both humoral and cell-mediated responses. The following methodological approaches are recommended:

  • Humoral immunity assessment:

    • ELISA assays using purified recombinant HERV-K_22q11.21 Env

    • Western blot analysis to confirm antibody specificity

    • Epitope mapping to identify immunodominant regions

    • Neutralization assays if fusogenic activity is demonstrated

  • Cell-mediated immunity evaluation:

    • T-cell proliferation assays using peptides derived from HERV-K_22q11.21 Env

    • ELISpot for detecting antigen-specific T-cell responses

    • Intracellular cytokine staining to characterize T-cell functional profiles

    • HLA tetramer analysis for quantifying antigen-specific T cells

  • In vivo immune response studies:

    • Humanized mouse models for studying human immune responses

    • Correlation of immune markers with expression levels in patient samples

    • Vaccination strategies in appropriate animal models

These approaches should be integrated with proper controls to account for potential cross-reactivity with other HERV-K Env proteins due to sequence similarities. Interestingly, studies have shown that HERV-K gag mRNA in peripheral blood mononuclear cells (PBMCs) can be predictive of prostate cancer diagnosis and correlates with elevated plasma interferon-γ and IP10 . Similar immunological correlations may exist for HERV-K_22q11.21 Env and warrant investigation.

What are the major challenges in producing high-quality recombinant HERV-K_22q11.21 Env polyprotein for research applications?

Producing high-quality recombinant HERV-K_22q11.21 Env polyprotein presents several technical challenges that researchers must address to ensure reliable experimental results. These challenges and their solutions include:

  • Expression system selection:

    • Challenge: Different expression systems yield proteins with varying post-translational modifications and folding properties.

    • Solution: Select the appropriate expression system based on experimental requirements. Options include E. coli (for high yield of non-glycosylated protein), yeast, baculovirus (for insect cell expression), or mammalian cells (for native-like post-translational modifications) .

  • Protein solubility and stability:

    • Challenge: Hydrophobic regions in Env proteins often lead to aggregation and insolubility.

    • Solution: Optimize buffer conditions, consider fusion tags to enhance solubility, and employ directed evolution approaches to improve protein properties.

  • Purity and quality control:

    • Challenge: Ensuring consistent purity between batches for reproducible results.

    • Solution: Implement rigorous purification protocols aiming for ≥85% purity as determined by SDS-PAGE, combined with analytical techniques such as mass spectrometry for quality control .

  • Endotoxin contamination:

    • Challenge: Bacterial expression systems can introduce endotoxins that affect immunological experiments.

    • Solution: Request low endotoxin preparations when necessary for sensitive applications .

By addressing these challenges systematically, researchers can obtain high-quality recombinant HERV-K_22q11.21 Env polyprotein suitable for a wide range of experimental applications.

How can researchers overcome the limitations of detecting low-abundance HERV-K_22q11.21 Env expression in biological samples?

Detecting low-abundance HERV-K_22q11.21 Env expression in biological samples presents significant technical challenges that require specialized approaches:

  • Enhanced nucleic acid detection methods:

    • Nested PCR approaches with HERV-K_22q11.21-specific primers

    • Digital PCR for absolute quantification of rare transcripts

    • Target enrichment strategies prior to RNA-Seq analysis

    • Long-read sequencing to distinguish between highly similar HERV-K loci

  • Protein detection enhancements:

    • Proximity ligation assays for increased sensitivity

    • Immunoprecipitation followed by mass spectrometry

    • Signal amplification methods for immunohistochemistry

    • Highly sensitive ELISA formats with optimized blocking and detection systems

  • Single-cell approaches:

    • Single-cell RNA-Seq to identify rare expressing cells within heterogeneous populations

    • Single-cell protein analysis by mass cytometry

    • In situ hybridization combined with immunofluorescence for spatial context

These approaches should be implemented with appropriate controls and validation steps. For instance, studies have shown that expression of certain HERV-K elements can be near the limit of detection in normal prostate cells while being significantly elevated in specific cancer cell lines . This underscores the importance of sensitive detection methods and careful experimental design when studying HERV-K_22q11.21 Env expression.

What are the potential applications of recombinant HERV-K_22q11.21 Env polyprotein in cancer research?

Recombinant HERV-K_22q11.21 Env polyprotein offers several valuable applications in cancer research, building on emerging evidence linking HERV-K elements to oncogenic processes:

  • Biomarker development:

    • Use as a standard for quantitative assays measuring HERV-K_22q11.21 Env expression

    • Development of antibodies for immunohistochemical detection in tumor samples

    • Establishment of ELISA systems for detecting anti-HERV-K_22q11.21 Env antibodies in patient sera

  • Functional studies:

    • Investigation of interactions with cellular signaling pathways relevant to cancer

    • Assessment of effects on cell proliferation, migration, and invasion

    • Evaluation of potential immunomodulatory properties in the tumor microenvironment

  • Therapeutic target exploration:

    • Screening platform for identifying inhibitors of HERV-K_22q11.21 Env function

    • Development of HERV-K_22q11.21 Env-targeted immunotherapies

    • Investigation as a tumor-associated antigen for cancer vaccines

While studies have indicated that HERV-K-22q11.21 expression was not detectable in certain prostate cancer cell lines , its expression and potential role in other cancer types remain to be fully explored. The differential expression patterns of HERV-K elements observed in prostate cancer (with HERV-K-22q11.23 and HERV-K17 showing correlation with PSA levels) suggest that comprehensive profiling across diverse cancer types may reveal cancer-specific HERV-K expression signatures .

How can HERV-K_22q11.21 Env polyprotein research contribute to understanding virus-host co-evolution?

Research on HERV-K_22q11.21 Env polyprotein provides a unique window into virus-host co-evolution, offering insights into how endogenous retroviral elements have been domesticated and repurposed throughout human evolution:

  • Comparative genomic approaches:

    • Analysis of HERV-K_22q11.21 sequence conservation across primate species

    • Reconstruction of ancestral sequences to understand evolutionary trajectories

    • Identification of selective pressures acting on the env gene

  • Functional evolution studies:

    • Comparison of ancestral versus modern Env protein functions

    • Investigation of interactions with host restriction factors

    • Assessment of fusion activity and receptor usage across evolutionary time

  • Host adaptation mechanisms:

    • Analysis of host genomic regions surrounding the HERV-K_22q11.21 locus

    • Investigation of epigenetic regulation mechanisms

    • Evaluation of potential roles in host defense against exogenous viruses

This research has significant implications for understanding how humans have evolved alongside retroviruses. The HML-2 subgroup of HERV-K, to which HERV-K_22q11.21 belongs, represents the most recently integrated HERV group into the human genome . Some HML-2 proviruses are both human-specific and/or polymorphic, indicating integration events subsequent to the human-chimpanzee split and continuing within modern humans . This recent evolutionary history makes HERV-K_22q11.21 particularly valuable for studying ongoing virus-host co-evolution processes.

What experimental design considerations are important when investigating potential immune responses to HERV-K_22q11.21 Env in autoimmune conditions?

Investigating the relationship between HERV-K_22q11.21 Env and autoimmune conditions requires carefully designed experiments that address several methodological considerations:

  • Patient cohort selection:

    • Well-defined autoimmune disease cohorts with appropriate controls

    • Stratification based on disease subtype, severity, and treatment history

    • Consideration of genetic background, particularly HLA types

  • Immune response profiling:

    • Comprehensive assessment of antibody responses (isotypes, epitope specificity)

    • T-cell reactivity testing with HERV-K_22q11.21 Env-derived peptides

    • Cytokine profiling to characterize inflammatory signatures

  • Molecular mimicry evaluation:

    • Epitope mapping to identify regions shared between HERV-K_22q11.21 Env and self-antigens

    • Cross-reactivity testing of autoantibodies with HERV-K_22q11.21 Env

    • Structural biology approaches to characterize shared epitopes

  • Mechanistic studies:

    • Animal models expressing HERV-K_22q11.21 Env to assess autoimmune pathology

    • In vitro models to evaluate effects on immune cell activation and tolerance

    • Intervention studies targeting HERV-K_22q11.21 Env expression or function

These investigations should be interpreted in the context of broader HERV-K biology. Studies have shown that HERV-K elements can influence immune responses, as evidenced by the correlation between HERV-K gag mRNA in PBMCs and elevated plasma interferon-γ and IP10 in prostate cancer patients . Similar immune correlations may exist in autoimmune contexts and warrant thorough investigation.

What bioinformatic approaches are recommended for analyzing HERV-K_22q11.21 expression in multi-omics datasets?

Analyzing HERV-K_22q11.21 expression in multi-omics datasets requires specialized bioinformatic strategies to address the challenges associated with repetitive elements and highly similar sequences:

  • Transcriptomic analysis:

    • Custom reference genomes including annotated HERV-K_22q11.21 sequences

    • Specialized alignment algorithms optimized for repetitive regions

    • Junction analysis to identify spliced transcripts

    • Differential expression analysis with appropriate statistical corrections

  • Integration with other omics data:

    • Correlation with DNA methylation status at the HERV-K_22q11.21 locus

    • Integration with histone modification data to understand chromatin-level regulation

    • Proteogenomic approaches to validate protein expression

    • Pathway analysis incorporating HERV-K_22q11.21 Env interaction partners

  • Visualization and interpretation tools:

    • Custom genome browsers for HERV visualization

    • Network analysis to identify functional associations

    • Machine learning approaches for pattern recognition across multi-omics datasets

These approaches should be implemented with careful attention to technical artifacts that can arise when analyzing repetitive elements. The differential expression patterns observed for various HERV-K elements in prostate cancer highlight the importance of locus-specific analysis rather than family-wide approaches when studying HERV-K_22q11.21.

How can researchers design experiments to investigate the potential role of HERV-K_22q11.21 Env in cellular signaling pathways?

Investigating the potential role of HERV-K_22q11.21 Env in cellular signaling requires systematic experimental approaches that can distinguish direct effects from indirect consequences:

  • Expression system design:

    • Inducible expression systems for temporal control

    • Domain truncation and mutation studies to map functional regions

    • Subcellular targeting variants to identify compartment-specific effects

  • Signaling pathway analysis:

    • Phosphoproteomic profiling before and after HERV-K_22q11.21 Env expression

    • Transcription factor activation assays

    • Calcium signaling and second messenger measurements

    • High-content imaging for morphological and phenotypic changes

  • Interaction studies:

    • Co-immunoprecipitation followed by mass spectrometry

    • Proximity labeling approaches (BioID, APEX) to identify neighborhood proteins

    • FRET/BRET assays for direct interaction partners

    • Yeast two-hybrid or mammalian two-hybrid screening

  • Functional validation:

    • Pathway inhibitor studies to confirm signaling mechanisms

    • siRNA/CRISPR screens to identify essential components

    • Rescue experiments with pathway components

These experimental approaches should be designed with appropriate controls, including inactive HERV-K_22q11.21 Env mutants and related HERV-K Env proteins to distinguish specific from general effects. The reported androgen-responsive regulation of some HERV-K elements suggests that hormone signaling pathways may be particularly relevant for investigation in the context of HERV-K_22q11.21 Env function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.