Recombinant Human Histamine H2 receptor (HRH2)

Shipped with Ice Packs
In Stock

Description

Classification and Structure

The Histamine H2 Receptor belongs to the family 1 of G protein-coupled receptors (GPCRs), characterized by its seven transmembrane α-helices, three intracellular loops, and three extracellular loops . GPCRs represent the most abundantly expressed receptor type in the central nervous system, allowing precise and dynamic responses to both endogenous and exogenous stimuli . The recombinant human form of this receptor is typically engineered with specific tags to facilitate detection, purification, and functional studies in research settings.

The receptor's structural design is fundamental to its function, particularly in its ability to transduce extracellular histamine binding into intracellular signaling cascades. When expressed recombinantly, the HRH2 is often constructed with a DDDDK tag at the N-terminus, while some fusion protein variants feature additional elements such as a C-terminal linkage to G-protein alpha subunits with a His tag . These structural modifications enhance the receptor's utility in experimental settings without compromising its native binding properties.

Signaling Mechanisms

The HRH2 receptor predominantly signals through the Gαs subunit, which promotes the generation of 3'-5'-cyclic adenosine monophosphate (cAMP) . This signaling pathway is crucial for various cellular responses, including inflammatory signaling through the phosphoinositide 3-kinase/AKT (PI3K/AKT) pathway. This mechanism has significant implications in neurodegenerative conditions such as Alzheimer's disease and plays a key role in regulating microglial function and stimulation . The receptor's signaling capabilities make it an important target for pharmacological intervention in multiple disease states.

Recombinant Expression Methods

The production of recombinant human HRH2 employs several expression systems, with baculovirus-infected Sf9 insect cells being a predominant choice for full-length protein expression . This system offers advantages in post-translational processing capabilities, which are essential for proper receptor folding and function. The expressed recombinant receptor can be engineered as a standalone protein or as fusion constructs with various G-protein alpha subunits to enhance functional studies.

Commercial preparations of the receptor are available with specific modifications to facilitate research applications. For instance, some preparations feature the receptor tagged at the N-terminus with a DDDDK tag, while the C-terminus is linked to Gq alpha with a His tag . These modifications enable easier detection, purification, and functional analysis without compromising the receptor's native properties.

Membrane Preparations

For research applications, membrane preparations containing the recombinant human HRH2 offer significant advantages. These preparations are typically derived from cells that express either recombinant or endogenous receptors and are optimized for binding assays . The table below outlines the typical specifications of such membrane preparations:

FeatureSpecification
Protein Concentration2 μg/μL protein
Volume400.0 μL
μg protein/unit2 μg protein / unit
Buffer Composition50 mM Tris-HCL (pH 7.4), 0.5mM EDTA, 10mM MgCl2, 10% sucrose
G-Alpha Natural ReceptorGs
Host Cell LineCHO-K1
Host SpeciesHuman
Target ClassGPCR
Validation MethodBinding

These membrane preparations undergo stringent quality control testing, including saturation radioligand binding assays to determine receptor concentration (Bmax) and affinity (Kd), as well as competition binding assays to determine affinity (Ki) against known reference agonists and antagonists . For certain Gi-coupled receptors, GTPγS data is also provided to enhance characterization.

Binding Properties and Assay Systems

The characterization of HRH2 and its interactions with ligands has benefited from the development of advanced binding assay systems. One such system is the NanoBRET binding assay, which represents a homogeneous live cell-based approach using fluorescently labeled compounds . This technique offers advantages over traditional radioligand binding assays, including real-time monitoring capabilities and enhanced safety profiles.

In one notable study, a squaramide-type compound labeled with Py-1 (designated as UR-KAT478) demonstrated suitable properties for BRET saturation binding experiments, with a receptor affinity (pKd) of 7.35 and favorable signal intensity . Real-time kinetic experiments with this ligand showed complete association within approximately 30 minutes and slow dissociation from the receptor, providing valuable insights into the binding dynamics of HRH2 .

The validation of these fluorescence-based binding assays has shown good correlation with traditional radioligand binding data, establishing their reliability for characterizing novel ligands targeting the HRH2 receptor . These methodologies represent significant advances in the receptor research toolbox, enabling more detailed investigations into receptor-ligand interactions.

Cellular Effects and Signaling

Research has demonstrated that HRH2 plays significant roles in various cellular processes, particularly in immune cells. In human microglia, activation of HRH2 has been shown to influence cellular prion protein (PrPC) expression . Specifically, treatment with the HRH2 agonist amthamine increased surface PrPC expression, while pre-treatment with the HRH2 antagonist ranitidine prevented this histamine-induced increase .

Investigation using various histamine receptor agonists (HTMT for HRH1, amthamine for HRH2, R-(—)-α-methylhistamine for HRH3, and 4-methylhistamine for HRH4) confirmed that HRH2 activation specifically increased PrPC expression relative to untreated controls . Interestingly, while HRH2 appeared to be the primary receptor responsible for histamine-induced changes in PrPC surface expression, blocking this receptor only partially affected cytokine release, suggesting complex and pathway-specific roles for HRH2 in immune modulation .

Impact on Immune Cell Populations

The effects of HRH2 blockade on immune function have been investigated in clinical studies, revealing significant immunomodulatory properties. In a single-center, single-arm clinical study involving 29 healthy subjects who received high-dose ranitidine (an HRH2 antagonist) for six weeks, notable impacts on immune cell populations were observed .

While ranitidine treatment showed no effect on neutrophils, basophils, or eosinophils, it significantly decreased numbers of B cells and IL-2Rα (CD25)-expressing T cells . Remarkably, these reductions persisted even after treatment cessation, suggesting sustained immunomodulatory effects of HRH2 blockade. Additionally, reduced serum levels of IL-2 were observed during treatment and remained low after the intervention ended .

These findings highlight previously unrecognized immunomodulatory effects of HRH2 blockade, which may have important implications for vaccination strategies and immunotherapy approaches. The long-term nature of these effects suggests that HRH2 may play fundamental roles in regulating immune cell development or homeostasis beyond its more well-known functions in gastric acid regulation .

Therapeutic Relevance

The HRH2 receptor represents an established target for treating gastroesophageal reflux disease (GERD) and peptic ulcer. HRH2 antagonists, including cimetidine, ranitidine, and famotidine, were among the first blockbuster drugs on the market in the 1970s, highlighting the historical importance of this receptor in pharmaceutical development .

Beyond gastrointestinal applications, current research on central nervous system (CNS)-penetrating HRH2 ligands, particularly agonists, continues to explore the receptor's role in the brain, which remains incompletely understood . The discovery of immune-modulating effects of HRH2 blockade also suggests potential applications in cancer settings, where clinical benefits have been reported .

The development of recombinant HRH2 systems and associated assay technologies has facilitated the search for novel ligands with improved properties, potentially enabling more targeted therapeutic approaches with fewer off-target effects. This ongoing research may lead to new therapeutic opportunities in various disease contexts where histamine signaling plays a role.

Expanded Understanding of Physiological Roles

While the role of HRH2 in gastric acid secretion is well-established, its functions in other tissues, particularly in the immune system and central nervous system, warrant further investigation. The observed effects of HRH2 blockade on B cells and T cells suggest complex roles in immune regulation that remain to be fully elucidated . Similarly, the receptor's functions in the brain represent an area of active research, with potential implications for neurological and psychiatric conditions .

The continued development and refinement of recombinant HRH2 systems will facilitate these investigations, providing valuable tools for exploring the receptor's diverse physiological roles and potential as a therapeutic target beyond current applications.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will fulfill your requests to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please contact your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize its development.
Synonyms
HRH2; Histamine H2 receptor; H2R; HH2R; Gastric receptor I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MAPNGTASSFCLDSTACKITITVVLAVLILITVAGNVVVCLAVGLNRRLRNLTNCFIVSL AITDLLLGLLVLPFSAIYQLSCKWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV MDPLRYPVLVTPVRVAISLVLIWVISITLSFLSIHLGWNSRNETSKGNHTTSKCKVQVNE VYGLVDGLVTFYLPLLIMCITYYRIFKVARDQAKRINHISSWKAATIREHKATVTLAAVM GAFIICWFPYFTAFVYRGLRGDDAINEVLEAIVLWLGYANSALNPILYAALNRDFRTGYQ QLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR
Uniprot No.

Target Background

Function
The H2 subclass of histamine receptors mediates gastric acid secretion. It also appears to regulate gastrointestinal motility and intestinal secretion. It may play a role in regulating cell growth and differentiation. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase and, through a separate G protein-dependent mechanism, the phosphoinositide/protein kinase (PKC) signaling pathway.
Gene References Into Functions
  1. Pharmacological or genetic modulations of H2 and H4 HRs (H2R and H4R) not only suppressed gefitinib-induced cytostasis and differentiation of AML cells but also blocked EGFR and ERK1/2 inhibition in MDA-MB-231 cells PMID: 27180173
  2. High constitutive Akt2 activity in U937 promonocytes: effective reduction of Akt2 phosphorylation by the histamine H2-receptor and the beta2-adrenergic receptor PMID: 26475619
  3. Lack of Association between rs2067474 Polymorphism in Histamine Receptor H2 Gene and Breast Cancer in Chinese Han Population PMID: 25922853
  4. Cimetidine reversed the exercise-induced improvement in learning and memory in rats. Central histamine H2 receptors play an important role in mediating the beneficial effects of forced exercise on learning and memory. PMID: 25192644
  5. upregulated on T regs following seasonal pollen exposure; allergen immunotherapy had no impact on the expression PMID: 24980224
  6. The inhibitory effects of histamine on reactive oxygen species production in whole blood phagocytes are caused by H2R rather than H4R histamine receptors. PMID: 24530738
  7. HR signaling through cyclic AMP and exchange protein directly activated by cyclic AMP was required for the histamine effect on LPS-induced monocyte-derived dendritic cells responses PMID: 23465664
  8. rs2607474 GG homozygote confers a significantly increased risk for age- and inflammation-related DAPK and CDH1 methylation in gastric epithelium. PMID: 23280118
  9. HR2 receptor is involved in histamine-induced GDF-15 expression. PMID: 22975449
  10. The results suggest that HRH2 -1018 GG homozygote is a risk factor for the severity of gastric mucosal atrophy under the influence of H. pylori infection, especially in older subjects. PMID: 22720301
  11. 1018 GG homozygosity of HRH2 may be associated with the severity of gastric mucosal atrophy PMID: 22615049
  12. Excitation of dentate nucleus neurons by histamine suggests that initiation and planning of movement is modulated by histaminergic projections. PMID: 21683759
  13. GRK2 induces desensitization of H2R through a phosphorylation-independent and RGS-dependent mechanism PMID: 21705320
  14. Results describe the interactions between human H2 receptor and its agonists. PMID: 21212009
  15. expression of H(2) during nicotinamide-induced differentiation of human amniotic epithelial cells into pancreatic beta-like cells may define a time-point, indicating involvement of histamine at the earlier stages PMID: 20012462
  16. histamine up-regulates LOX-1 expression via the H2 receptor in THP-1 monocytes PMID: 11728449
  17. Stimulation of phosphodiesterase IV is mediated by the H2 receptor and related to intracellular levels of cAMP. PMID: 12824943
  18. Data show that the rapid and prolonged modulation of cell surface histamine H2 receptor levels by histamine was regulated solely via internalization. PMID: 14523557
  19. significant differences in H2 receptor expression in different vascular cell types might play a critical role in histamine induced cellular responses PMID: 15167968
  20. human mast cells constitutively express primarily H2 and H4 receptors and that H2 receptors are functionally linked to cellular processes. PMID: 15191551
  21. Involvement of histamine H2 receptors in the histamine induced ets-1 expression in melanoma cells PMID: 15848191
  22. The equilibrium between receptor endocytosis and recycling is altered before H2R upregulation, probably via suppressing H2R degradation. PMID: 15961859
  23. histamine exerts both a proproliferative and a proangiogenic effect via H2/H4 receptor activation, mediated by increasing COX-2-related PGE2 production in COX-2-expressing colon cancer cells PMID: 16203768
  24. The point mutation Cys-17 to Tyr-17 in the human histamine H2 receptor results in the formation of an H-bond between Tyr-17 and Asp-271 , favoring the stabilization of an active receptor conformation. PMID: 17347323
  25. HRH2 trafficking was analyzed by examination of the roles of arrestin, dynamin, and clathrin on HRH2 internalization. PMID: 18617631
  26. These results suggest that the agonist-induced H2R internalization and ERK1/2 activation are partially dynamin-dependent. Furthermore, ERK1/2 activation via H2R is likely dependent of the endocytotic process rather than dynamin itself. PMID: 18691388
  27. role in allergy, autoimmunity, graft rejection, malignancy PMID: 18802338
  28. H2r exposure to an agonist caused desensitization controlled by H2r phosphorylation via GRK2 and GRK3. PMID: 11641433
  29. Histamine H2 receptors regulate intracellular Ca2+ levels exclusively by activation of nonselective cation channels, an effect which is inhibited via specific activation of protein kinase C isoform. PMID: 11466390

Show More

Hide All

Database Links

HGNC: 5183

OMIM: 142703

KEGG: hsa:3274

STRING: 9606.ENSP00000366506

UniGene: Hs.247885

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of the histamine H2 receptor?

The histamine H2 receptor (H2R) is a G protein-coupled receptor (GPCR) that plays crucial roles in multiple physiological systems, particularly in cardiovascular function. Structurally, H2R operates through Gs-protein coupling, initiating adenylyl cyclase activity that increases intracellular cAMP levels. This signaling cascade mediates the receptor's primary physiological effects. In cardiac tissue, H2R activation triggers positive inotropic and chronotropic responses through cAMP-dependent pathways that influence calcium handling and contractile machinery.

The receptor shows differential affinity for histamine compared to other histamine receptor subtypes (H1, H3, and H4), notably having the lowest affinity for histamine among all four receptor types. This property is physiologically significant as it indicates H2R may be preferentially activated only when histamine concentrations reach higher thresholds .

How does the H2 receptor differ from other histamine receptor subtypes?

The H2 histamine receptor differs from other histamine receptor subtypes (H1, H3, and H4) in several key aspects:

  • Signal transduction: While H2R primarily couples to Gs proteins to increase cAMP production, H1R couples to Gq proteins activating the phospholipase C pathway, and H3R and H4R couple to Gi/o proteins inhibiting adenylyl cyclase.

  • Binding affinity: Histamine has a lower affinity for H2R compared to the other receptor subtypes, particularly H3R and H4R for which histamine shows notably higher affinity .

  • Pharmacological profile: H2R responds to specific agonists like dimaprit, although this compound also activates H3 and H4 receptors with even greater potency. More selective compounds such as "compound 16" show greater H2R specificity .

  • Physiological roles: H2R is particularly important in regulating cardiac contractility and rhythm, gastric acid secretion, and certain immune functions, whereas other receptor subtypes have different primary physiological roles.

What are the key signal transduction pathways associated with H2 receptor activation?

The primary signal transduction pathway associated with H2 receptor activation involves coupling to Gs proteins, which stimulate adenylyl cyclase to increase intracellular cAMP production. This pathway initiates several downstream effects:

  • Protein Kinase A (PKA) activation: Elevated cAMP activates PKA, which phosphorylates numerous cellular targets including L-type calcium channels, phospholamban, and contractile proteins in cardiac myocytes.

  • Exchange Protein Activated by cAMP (EPAC): Independent of PKA, cAMP can activate EPAC proteins that regulate additional cellular processes.

  • Phosphodiesterase modulation: The pathway involves feedback through phosphodiesterases that hydrolyze cAMP, regulating signal duration and intensity.

In cardiac tissue, these mechanisms contribute to the positive inotropic (increased contractility) and chronotropic (increased heart rate) effects following H2R activation . The receptor's signaling pathways are comparable to β-adrenergic receptor stimulation but with distinctive kinetics and regulatory features that may provide unique therapeutic opportunities in cardiovascular contexts.

What are the current methods for studying recombinant H2 receptor binding and function?

Modern research employs several sophisticated techniques to study recombinant H2 receptor binding and function:

  • NanoBRET binding assay: This technique uses bioluminescence resonance energy transfer to measure ligand-receptor interactions in live cells without requiring separation steps. The assay involves a NanoLuc-tagged H2 receptor and fluorescently labeled ligands. When the substrate is added, the enzyme catalyzes an oxidation reaction emitting blue light. If a fluorescent ligand binds to the tagged receptor, BRET occurs, allowing detection of receptor-bound ligand with lower non-specific binding .

  • Real-time kinetic experiments: These provide dynamic information about ligand-receptor interactions. For example, using the fluorescent squaramide-type ligand labeled as compound 8 (UR-KAT478), researchers can monitor association within approximately 30 minutes and slower dissociation kinetics with a half-life of about 300 minutes .

  • Radioligand binding assays: Traditional methods using radiolabeled ligands remain valuable for determining binding affinities and receptor densities.

  • Molecular studies using gene deletion or overexpression: These approaches, particularly in genetically modified mice, allow for examination of receptor function in various physiological systems.

  • Adenoviral constructs: These enable controlled expression of wild-type or mutant receptors in various cell types to study structure-function relationships .

How can I establish a NanoBRET binding assay for the H2 receptor?

Establishing a NanoBRET binding assay for the histamine H2 receptor requires several critical steps:

  • Receptor preparation: Generate a construct where NanoLuc luciferase is fused to the N-terminus of the H2 receptor. This fusion protein must be expressed in a suitable cell line maintaining proper receptor trafficking and function.

  • Selection of fluorescent ligands: Synthesize or obtain fluorescently labeled H2 receptor ligands with appropriate pharmacophores. Based on recent research, squaramide-type compounds have proven effective, with Py-1-labeled ligand 8 (UR-KAT478) demonstrating optimal characteristics (pKd = 7.35) and good signal intensity .

  • Assay optimization:

    • Determine optimal cell density and expression levels

    • Optimize substrate concentration and incubation conditions

    • Establish appropriate signal detection parameters for your plate reader

  • Validation protocol:

    • Perform saturation binding experiments to determine binding affinity (Kd)

    • Conduct competition binding assays with reference compounds

    • Compare results with established methods (e.g., radioligand binding)

    • Execute real-time kinetic measurements to analyze association and dissociation rates

The BRET-based approach yields binding data comparable to conventional methods while offering advantages of real-time monitoring without separation steps. This homogeneous live cell-based assay allows for convenient determination of affinity constants for putative H2 receptor ligands regardless of their mechanism of action .

What are the key parameters to measure when characterizing novel H2 receptor ligands?

When characterizing novel H2 receptor ligands, researchers should measure several critical parameters:

  • Binding affinity (Kd or Ki):

    • Determine through saturation binding experiments

    • Validate via competition binding assays against established reference ligands

    • Express as pKd or pKi values for standardized comparison

  • Binding kinetics:

    • Association rate (kon): Measure time course of binding

    • Dissociation rate (koff): Determine by displacement with excess competing ligand

    • Residence time (1/koff): Calculate particularly for antagonists where longer receptor occupancy may correlate with clinical efficacy

  • Functional activity:

    • Efficacy: Determine maximum response relative to reference agonist

    • Potency: Measure EC50 or IC50 values

    • Intrinsic activity: Classify as full agonist, partial agonist, neutral antagonist, or inverse agonist

  • Selectivity profile:

    • Test against other histamine receptor subtypes (H1, H3, H4)

    • Screen against related GPCRs and potential off-target binding sites

  • Signaling bias:

    • Evaluate activation of different downstream pathways (G-protein vs. β-arrestin)

    • Quantify pathway-specific potency and efficacy

For example, in BRET binding experiments with compound 8, researchers observed a binding affinity (pKd) of 7.35, full association within approximately 30 minutes, and slow dissociation with a half-life of 300 minutes, providing comprehensive characterization of its binding properties .

What are the most selective agonists and antagonists for the human H2 receptor?

The development of selective H2 receptor ligands has been challenging due to cross-reactivity with other histamine receptor subtypes. Current research identifies several compounds with notable selectivity:

Selective H2R Agonists:

  • Compound 16: Currently recognized as one of the most potent and selective agonists for the H2 receptor .

  • Apromidine: A dimaprit derivative that shows positive inotropic effects in guinea pig hearts without altering heart rate, suggesting selective H2R activation in cardiac tissue .

  • Dimaprit: One of the first identified H2R-selective agonists, though now known to have higher potency at H3 and H4 receptors .

Selective H2R Antagonists:

  • Famotidine: A clinically used H2R antagonist with relatively high selectivity and affinity.

  • Ranitidine and Cimetidine: First-generation H2R antagonists with established clinical profiles.

The table below summarizes key pharmacological properties of selected H2R ligands:

CompoundClassificationSelectivityNotable Properties
Compound 16AgonistHigh H2R selectivityHigh potency at H2R
ApromidineAgonistCardiac-selective effectsPositive inotropy without chronotropy
DimapritAgonistLow (acts on H2R, H3R, H4R)Higher potency at H3R and H4R than H2R
FamotidineAntagonistHigh H2R selectivityUsed clinically for acid-related disorders

It's important to note that histamine itself is a non-selective agonist with the lowest affinity for H2R compared to other histamine receptor subtypes .

How do binding properties of fluorescent ligands compare to traditional radioligands for the H2 receptor?

Fluorescent ligands offer distinct advantages and challenges compared to traditional radioligands for H2 receptor studies:

Comparative Analysis:

  • Affinity: Modern fluorescent probes like compound 8 (UR-KAT478) demonstrate binding affinities (pKd = 7.35) comparable to traditional radioligands. When tested against reference compounds in BRET-based competition binding experiments, the pKi values obtained were consistent with radioligand binding data .

  • Signal-to-noise ratio: Fluorescent probes used in BRET assays provide improved signal-to-noise ratios due to the proximity-based detection that primarily measures receptor-bound ligand, reducing apparent non-specific binding.

  • Kinetic resolution: BRET-based systems with fluorescent ligands allow real-time monitoring of binding events, providing detailed kinetic information. For example, compound 8 shows full association within approximately 30 minutes and slow dissociation with a half-life of 300 minutes .

  • Safety and practicality: Fluorescent probes eliminate radiation hazards, special disposal requirements, and licensing associated with radioligands.

  • Structural considerations: The addition of fluorophores can affect pharmacological properties, requiring careful design to maintain the binding characteristics of the parent molecule. For example, the study of different fluorescently labeled squaramide-type compounds revealed that Py-1-labeled ligand 8 offered the optimal balance of receptor affinity and signal intensity .

The BRET binding assay represents a versatile alternative to canonical binding assays, providing comparable data while enabling more detailed kinetic analysis without separation steps .

What structural features of ligands determine selectivity between histamine receptor subtypes?

The selectivity of ligands between different histamine receptor subtypes is determined by several key structural features:

  • Core pharmacophore: The imidazole ring present in histamine serves as a common recognition element across all receptor subtypes, but modifications to this core significantly affect subtype selectivity.

  • Side chain properties: The length, flexibility, and chemical nature of side chains extending from the core structure critically influence receptor subtype binding:

    • H2R-selective ligands typically feature more extended, flexible side chains

    • H1R ligands often incorporate bulkier aromatic substituents

    • H3R/H4R selective compounds frequently include more rigid spacers with specific distance constraints

  • Charge distribution: The distribution of positive charges plays a crucial role in selectivity, with H2R ligands typically requiring a specific protonation pattern different from other subtypes.

  • Hydrogen bonding capabilities: The number and position of hydrogen bond donors and acceptors significantly impact subtype selectivity.

  • Spatial orientation: The three-dimensional arrangement of functional groups determines how ligands interact with the binding pocket of each receptor subtype.

In research with squaramide-type compounds, structural modifications including the attachment position and nature of the fluorophore (such as in compound 8) significantly affected H2R binding properties . This highlights the importance of rational structure-based design in developing selective ligands for histamine receptor subtypes.

What are the cardiovascular effects of H2 receptor activation?

H2 receptor activation produces significant cardiovascular effects through multiple mechanisms:

  • Positive inotropic effect (increased contractility):

    • H2R activation increases intracellular cAMP through Gs-protein coupling

    • This enhances calcium handling in cardiomyocytes, increasing contractile force

    • The effect resembles β-adrenergic stimulation but with distinct pharmacological properties

    • Compounds like apromidine demonstrate positive inotropic effects without changing heart rate in guinea pig hearts

  • Chronotropic effects (heart rate modulation):

    • H2R activation can increase heart rate through sinoatrial node stimulation

    • Some H2R agonists show selective effects on contractility without chronotropic effects, suggesting tissue-specific signaling mechanisms

  • Electrophysiological effects:

    • Altered cardiac action potential duration

    • Potential arrhythmogenic effects under specific pathological conditions

    • Modulation of cardiac ion channels through cAMP-dependent pathways

  • Vascular effects:

    • H2R-mediated vasodilation in various vascular beds

    • Blood pressure regulation through direct vascular effects and interaction with other cardiovascular control mechanisms

These effects have implications for both normal cardiac physiology and pathological conditions including ischemia-reperfusion injury, arrhythmias, and heart failure, suggesting potential therapeutic applications for H2R-targeting compounds .

What adverse events are associated with H2 receptor antagonists based on real-world data?

Pharmacovigilance studies using real-world data from the FDA Adverse Event Reporting System (FAERS) have identified several adverse events (AEs) associated with H2 receptor antagonists, particularly famotidine:

Established Adverse Events (consistent with drug labeling):

  • Gastrointestinal effects: Abdominal pain, abdominal discomfort, dyspepsia, gastrooesophageal reflux disease

  • Hepatic effects: Liver disorders

  • Musculoskeletal effects: Rhabdomyolysis

Newly Identified Potential Adverse Events:

  • Neurological: Cerebral infarction, hallucination (visual)

  • Metabolic/Endocrine: Hypocalcemia, hypomagnesemia, hypoparathyroidism, diabetes insipidus

  • Oncological: Retro-orbital neoplasm, neuroblastoma recurrent, malignant cranial nerve neoplasm

  • Infectious: Vulvovaginal candidiasis

The disproportionality analysis covered FAERS data from the first quarter of 2004 to the first quarter of 2023, providing a comprehensive view of potential safety signals. Importantly, these newly identified AE signals require confirmation through prospective clinical studies to establish causal relationships and underlying mechanisms.

This pharmacovigilance approach highlights the importance of post-marketing surveillance in identifying rare or unexpected adverse events that may not be detected during clinical trials due to limited sample sizes or durations .

What is the potential therapeutic role of H2 receptor modulation in cardiac disease?

The modulation of histamine H2 receptors presents several potential therapeutic approaches in cardiac disease:

  • Acute cardiac support:

    • H2R agonists could potentially increase cardiac contractility in acute heart failure

    • Unlike traditional inotropic agents, H2R agonists might offer unique signaling profiles

    • Historical clinical studies in the 1980s investigated H2R agonists for this purpose, though side effects including gastric acid production limited their development

  • Chronic heart failure management:

    • Paradoxically, H2R antagonists have shown potential benefits in chronic heart failure models

    • This suggests complex, time-dependent roles of H2R signaling in cardiac pathophysiology

    • Novel animal and clinical research is exploring these mechanisms

  • Arrhythmia management:

    • H2R plays a role in cardiac rhythm regulation and potential arrhythmogenesis

    • Selective modulation of H2R signaling pathways might provide antiarrhythmic strategies

    • Understanding the electrophysiological effects requires further investigation

  • Ischemia-reperfusion protection:

    • H2R modulation may influence cardiac response to ischemia-reperfusion injury

    • This suggests potential applications in myocardial infarction and cardiac surgery settings

The complexity of H2R signaling suggests that developing cardiomyocyte-specific H2R agonists and antagonists could offer more targeted therapeutic approaches with fewer systemic side effects . Further research is needed to fully characterize the time-dependent and context-specific effects of H2R modulation in various cardiac pathologies.

What are the challenges in developing cardiomyocyte-specific H2 receptor modulators?

Developing cardiomyocyte-specific H2 receptor modulators presents several significant challenges:

  • Receptor subtype specificity:

    • Achieving selectivity for H2R over other histamine receptor subtypes (H1, H3, H4)

    • Current agonists like dimaprit show higher potency at H3R and H4R than at H2R

    • Even "compound 16," considered among the most potent H2R agonists, faces selectivity limitations

  • Tissue-specific targeting:

    • Delivering compounds specifically to cardiac tissue while avoiding other H2R-expressing tissues (gastric mucosa, vascular smooth muscle, immune cells)

    • Requires innovative drug delivery systems or exploitation of cardiomyocyte-specific signaling pathways

    • Limited understanding of tissue-specific H2R coupling mechanisms complicates development

  • Signaling pathway selectivity:

    • H2R couples to multiple downstream pathways (cAMP/PKA, EPAC, potentially others)

    • Developing biased ligands that selectively activate beneficial pathways while avoiding detrimental ones

    • Understanding which signaling cascades mediate specific cardiac effects remains incomplete

  • Temporal considerations:

    • Balancing acute positive inotropic effects against potential long-term adverse remodeling

    • Historical attempts to use H2R agonists for acute cardiac support faced limitations including side effects

    • Addressing appropriate dosing regimens for acute versus chronic administration

  • Translational barriers:

    • Significant species differences in H2R pharmacology between model organisms and humans

    • Moving from promising preclinical findings to successful clinical applications

Future development may require integrated approaches combining medicinal chemistry, advanced drug delivery systems, and deeper understanding of cardiomyocyte-specific H2R signaling mechanisms .

How can contradictory findings about H2 receptor effects in acute versus chronic cardiac conditions be resolved?

Resolving contradictory findings regarding H2 receptor effects in acute versus chronic cardiac conditions requires a multi-faceted research approach:

  • Temporal dynamics investigation:

    • Design longitudinal studies tracking H2R signaling changes over disease progression

    • Implement time-course experiments with detailed molecular phenotyping

    • Compare acute H2R activation effects with chronic receptor stimulation/inhibition

  • Pathway-specific analysis:

    • Use biased ligands or genetic approaches to dissect specific signaling cascades

    • Implement CRISPR-based techniques to modify specific H2R signaling components

    • Employ pathway-selective inhibitors to isolate contributions of individual signaling branches

    • Develop computational models integrating multiple H2R-associated pathways

  • Context-dependent signaling:

    • Study H2R function under varying physiological and pathological conditions

    • Investigate receptor cross-talk with other cardiac signaling systems (β-adrenergic, angiotensin)

    • Examine the impact of cardiac remodeling on H2R expression and coupling

  • Translational considerations:

    • Historical clinical studies showed initial promise for H2R agonists in heart failure but encountered limitations including side effects

    • Revisit these findings with modern pharmacological tools and understanding

    • Design studies that specifically address temporal aspects of H2R modulation

  • Integrated systems approach:

    • Combine in vitro, ex vivo, and in vivo models to create a comprehensive understanding

    • Develop mathematical models predicting time-dependent responses to H2R modulation

    • Implement multi-omics approaches to capture system-wide effects of H2R activation/inhibition

This integrated approach may reconcile apparently contradictory findings by revealing that H2R signaling has fundamentally different effects depending on activation duration, disease stage, and specific cardiac cell types involved .

What methodological advances are needed to improve selectivity testing for novel H2 receptor ligands?

Advancing selectivity testing for novel H2 receptor ligands requires several methodological innovations:

  • High-throughput multiplex screening platforms:

    • Develop parallel testing systems for simultaneous assessment against all four histamine receptor subtypes

    • Implement NanoBRET or similar technologies with differentially colored fluorescent ligands

    • Create cell lines with standardized expression levels of multiple receptor subtypes

    • Design automated analysis pipelines for rapid comparison of selectivity profiles

  • Advanced binding kinetics characterization:

    • Expand real-time kinetic measurements beyond simple association/dissociation curves

    • Implement competition kinetic binding to determine kinetic selectivity parameters

    • Develop mathematical models accounting for complex binding behaviors

    • Current assays with compounds like UR-KAT478 provide detailed kinetic information but require expansion to competitive scenarios

  • Pathway-specific functional assays:

    • Create biosensor systems detecting specific signaling events downstream of receptor activation

    • Implement BRET/FRET-based assays monitoring multiple pathways simultaneously

    • Develop label-free methods assessing integrated cellular responses

    • Design organotypic models reflecting tissue-specific signaling environments

  • Structural biology integration:

    • Combine binding data with structural insights from cryo-EM or X-ray crystallography

    • Implement molecular dynamics simulations predicting ligand-receptor interactions

    • Develop structure-based screening approaches guided by binding pocket comparisons between receptor subtypes

  • In silico prediction tools:

    • Create machine learning algorithms predicting selectivity based on chemical structures

    • Develop computational models incorporating both binding affinities and activation efficacies

    • Implement systems pharmacology approaches predicting network-level effects

  • Standardized reference panels:

    • Establish comprehensive panels of reference compounds with well-characterized selectivity profiles

    • Create standardized protocols allowing cross-laboratory comparison of results

    • Develop publicly accessible databases of selectivity data

These methodological advances would provide more comprehensive evaluation of ligand selectivity across the histamine receptor family, facilitating the development of truly selective H2 receptor modulators .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.