Recombinant Human Histamine H4 receptor (HRH4)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Physiology and Disease

Immune Regulation

  • Mediates chemotaxis of eosinophils, mast cells, and macrophages to inflammation sites .

  • Enhances Th2 immune responses by suppressing IL-12 and IP10 in dendritic cells .

Inflammatory Pathways

  • HRH4 activation in macrophages increases IL-6 and VEGF secretion, exacerbating conditions like diabetic retinopathy (DR) .

  • Antagonists (e.g., JNJ7777120) reduce retinal vascular permeability and macrophage infiltration in DR models .

Metabolic and Oncogenic Roles

  • Promotes adipose tissue browning via p38/ERK-MAPK pathways, enhancing thermogenesis .

  • Downregulated in cancers, suggesting tumor-suppressive potential .

Table 1: HRH4 in Preclinical Studies

Study ModelInterventionKey OutcomeSource
STZ-induced DR miceHRH4 antagonist (JNJ7777120)Reduced macrophage infiltration, IL-6/VEGF levels, and retinal vascular leakage
MA-10 Leydig cellsHRH4 agonistsInhibited LH-induced cAMP production and steroidogenesis
C3H10T1/2 adipocytesHRH4 agonist (4MH)Induced browning, lipolysis, and UCP1/PGC1α upregulation
TNBS-induced colitis (rats)HRH4 antagonistAttenuated inflammatory symptoms

Therapeutic Applications

Inflammatory Diseases

  • HRH4 antagonists show efficacy in preclinical models of asthma, pruritus, and colitis .

  • JNJ7777120’s short half-life enables targeted dosing with minimal off-target effects .

Metabolic Disorders

  • HRH4 activation in adipocytes enhances energy expenditure, suggesting utility in obesity management .

Oncology

  • HRH4 agonists may counteract cancer-associated cachexia by modulating TNF-α signaling .

Clinical Relevance

  • Phase II trials demonstrate HRH4 antagonists reduce pruritus in atopic dermatitis patients .

  • Oral formulations of HRH4-targeted drugs are under development for chronic inflammatory conditions .

Challenges and Future Directions

  • Selectivity: HRH4 ligands must avoid cross-reactivity with HRH3 due to structural similarities .

  • Tissue-Specific Effects: HRH4’s role varies across tissues (e.g., pro-inflammatory in retina vs. anti-inflammatory in gut) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
HRH4; GPCR105; Histamine H4 receptor; H4R; HH4R; AXOR35; G-protein coupled receptor 105; GPRv53; Pfi-013; SP9144
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-390
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRSSYFFLNLAIS DFFVGVISIPLYIPHTLFEWDFGKEICVFWLTTDYLLCTASVYNIVLISYDRYLSVSNAV SYRTQHTGVLKIVTLMVAVWVLAFLVNGPMILVSESWKDEGSECEPGFFSEWYILAITSF LEFVIPVILVAYFNMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSA STEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARR LAKSLAILLGVFAVCWAPYSLFTIVLSFYSSATGPKSVWYRIAFWLQWFNSFVNPLLYPL CHKRFQKAFLKIFCIKKQPLPSQHSRSVSS
Uniprot No.

Target Background

Function
The H4 subclass of histamine receptors mediates histamine signaling in peripheral tissues. It exhibits significant constitutive activity (spontaneous activity in the absence of an agonist).
Gene References Into Functions

Histamine H4 Receptor (HRH4) Function: Research Highlights

  1. rs11662595, a loss-of-function polymorphism in HRH4, impairs its anti-epithelial-to-mesenchymal transition function in non-small cell lung cancer (NSCLC), offering potential as a prognostic and therapeutic biomarker. PMID: 28847511
  2. H4R silencing inhibited H4R-mediated mast cell functions and SAPK/JNK phosphorylation. H4R activation utilizes the SAPK/JNK signaling pathway for IL-1β release in HMC-1 cells. PMID: 29863427
  3. H4R plays a significant role in allergic disease pathophysiology by regulating Th1/Th2 mediator production and promoting Th2 lymphocyte accumulation in inflamed tissues, suggesting its potential as a therapeutic target. PMID: 29600327
  4. Elevated H4R expression in peripheral blood monocytes of rheumatoid arthritis patients; histamine and Th17 cytokines induce osteoclast differentiation, inhibited by JNJ7777120. PMID: 28446753
  5. H1R and H4R serve as biomarkers of allergic ocular surface inflammation, with eosinophil-expressed H4R specifically indicating eosinophilic inflammation. PMID: 28391980
  6. Histamine influences the IL-17 pathway in psoriasis via H4R on CD4+ T cells. PMID: 28592369
  7. HRH4 gene variations may be associated with specific psoriasis clinical features. PMID: 27725312
  8. HRH4 polymorphisms (rs77485247 and rs77041280) may influence allergic rhinitis risk and H1 antihistamine efficacy. PMID: 27888642
  9. H4R regulates IgE-dependent processes in human basophils, suggesting a role in negative feedback control of immune responses. PMID: 26948974
  10. Modulation of H2R and H4R suppresses gefitinib-induced cytostasis and differentiation of AML cells and blocks EGFR and ERK1/2 inhibition in MDA-MB-231 cells. PMID: 27180173
  11. H4R was not identified in several guinea pig models used to detect presynaptic inhibitory receptors, while H3R was found in peripheral tissues but not the hippocampus. PMID: 26211976
  12. Compounds A and L may block H4R-mediated downstream signaling. PMID: 27807993
  13. H4R activation in human mast cells induces the release of IL-13 and RANTES, activating divergent signaling pathways for cytokine and chemokine production. PMID: 27400655
  14. H4R may contribute to maintaining healthy oral mucosa, potentially impaired in oral lichen planus by mast cell degranulation and inflammatory cytokines. PMID: 25207698
  15. H4R activation induces ERK phosphorylation. PMID: 26828993
  16. HRH4 polymorphisms may be associated with ankylosing spondylitis susceptibility. PMID: 26823878
  17. H4 receptor expression is involved in pathological vessel leakage in choroidal neovascularization. PMID: 24787705
  18. Molecular modeling studies (molecular dynamics simulations and Gibbs energy of solvation calculations) were conducted on hH3R and hH4R. PMID: 25098339
  19. Functional H4 receptors (increasing 35S-GTPγS binding and/or decreasing noradrenaline release) were not found in human, guinea pig, or mouse cortex. PMID: 25300787
  20. Increased HRH4 expression in clinically isolated syndrome and multiple sclerosis stages compared to healthy controls. PMID: 25293806
  21. No evidence of histamine H4 receptor presence in monocytes. PMID: 25273276
  22. In neutrophils, the H4 receptor may block Mac-1-mediated degranulation signals, with H4 receptor agonists blocking Mac-1-dependent p38 MAPK activation. PMID: 24799603
  23. H4R activation in human mast cells produces inflammatory mediators associated with allergic and other inflammatory conditions. PMID: 24934979
  24. Increased H4 receptor expression observed in HaCaT cells post-differentiation. PMID: 24372819
  25. Histamine, via the H4 receptor, plays a crucial role in breast tumor progression. PMID: 23425150
  26. A cellular model for identifying new histamine H4 receptor-active compounds. PMID: 24432340
  27. Methyl substitution in histamine homologs enhances H4R selectivity. PMID: 24493592
  28. Individuals with copy number variations in HRH1, HRH2, and HRH4 genes were identified. PMID: 24236486
  29. H4 receptor activation down-regulates cAMP, inactivating the TGF-β1 pathway. PMID: 24447834
  30. H2R, not H4R, mediates histamine's inhibitory effects on reactive oxygen species production in whole blood phagocytes. PMID: 24530738
  31. High H4 receptor expression in atopic dermatitis keratinocytes, with stimulation inducing keratinocyte proliferation. PMID: 23932072
  32. Review of histamine and its receptors' role in Alzheimer's disease treatment. PMID: 23677734
  33. HRH4 copy number variations are associated with atopic dermatitis in a Chinese population. PMID: 23517361
  34. Increased histamine receptor-4 mRNA expression in the caudate nucleus and putamen of Parkinson's disease patients. PMID: 22118942
  35. HRH4 genotypes are associated with breast cancer risk and malignancy in Chinese Han populations. PMID: 23481304
  36. Efficacy of 31 hHR ligands in inducing Gαi protein signaling and β-arrestin2 recruitment. PMID: 22973061
  37. Down-regulation of HRH4 mRNA in rheumatoid arthritis synovial tissue compared to osteoarthritis. PMID: 21881994
  38. Three HRH4 SNPs (rs17187619, rs527790, rs487202) showed differing genotype distributions between asthmatic patients with and without infection-induced asthma. PMID: 22653292
  39. Voltage sensitivities and deactivation rates differed between histamine hH3R, hH3R, and H4 receptors. PMID: 22885137
  40. Fragment optimization and binding kinetics analysis for ligand-based design of novel histamine H receptor antagonists. PMID: 22153663
  41. HRH4 gene deletion in gastric cancer cases correlates with reduced gene expression. PMID: 22363581
  42. Review of HR structure modeling in drug discovery. PMID: 22201741
  43. Histamine H4 receptor as a potential therapeutic target for inflammatory and autoimmune disorders. PMID: 21741967
  44. Significant increase in histamine H4 receptors in allergic rhinitis nasal mucosa compared to normal nasal mucosa. PMID: 21171298
  45. H4R expression on plasmacytoid dendritic cells in psoriasis influences cytokine production and cell migration. PMID: 21614010
  46. Abnormal HRH4 expression may contribute to colorectal cancer progression. PMID: 21609450
  47. Genetic impact on histamine H4 receptor expression and its activity on atopic dermatitis effector cells. PMID: 21104170
  48. Splenic-dendritic cells (slanDC) express H4R; its stimulation reduces slanDC pro-inflammatory capacity. PMID: 20722760
  49. HRH4 copy number variations are associated with systemic lupus erythematosus. PMID: 20618322
  50. Langerhans cells express a functional H4R, suggesting its pathogenic relevance in inflammatory and allergic diseases. PMID: 19958313
Database Links

HGNC: 17383

OMIM: 606792

KEGG: hsa:59340

STRING: 9606.ENSP00000256906

UniGene: Hs.287388

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed primarily in the bone marrow and eosinophils. Shows preferential distribution in cells of immunological relevance such as T-cells, dendritic cells, monocytes, mast cells, neutrophils. Also expressed in a wide variety of peripheral tissues, inclu

Q&A

What is the tissue expression profile of HRH4 in humans?

HRH4 displays a distinctive expression pattern predominantly in immune cells and hematopoietic tissues. It is mainly expressed in bone marrow with restricted expression in immune cells including monocytes, macrophages, dendritic cells, and T cells. Beyond immune cells, HRH4 expression has been detected in multiple organs including the liver, colon, lung, spleen, small intestine, testes, tonsils, thymus, and trachea. Within the central nervous system, HRH4 has been identified in the cerebellum and hippocampus . Importantly, HRH4 expression can be dynamically regulated in lymphoid tissues, with either upregulation or downregulation observed upon activation, potentially influenced by specific cytokines such as IL-10 and IL-13 .

The expression profile in specific cell types is particularly relevant as it aligns with HRH4's immunomodulatory functions. For instance, HRH4 expression in macrophages increases under high glucose conditions (25 mM) compared to normal glucose (5 mM) conditions, suggesting a potential role in metabolic inflammatory diseases . In testicular tissue, HRH4 has been detected in Leydig cells from rats aged 7-240 days, with additional expression noted in male gametes within seminiferous tubules of 21-day-old rats .

How does HRH4 differ structurally from other histamine receptors?

HRH4 exhibits distinct structural characteristics that differentiate it from other histamine receptor subtypes:

Receptor ComparisonHomology to HRH4Evolutionary RelationshipMain Structural Distinctions
HRH1 (classical)Low homologyRemote evolutionary relationshipDistinct binding pocket architecture
HRH2 (classical)Low homologyRemote evolutionary relationshipDifferent G-protein coupling mechanism
HRH3~35% homologyClosest related receptorSimilar transmembrane domains

HRH4 is structurally unique compared to the classical pro-inflammatory H1 receptor and the H2 receptor, showing little sequence homology with these subtypes. Interestingly, HRH4 shows approximately 35% homology with the H3 receptor, making H3 its closest related histamine receptor subtype . This structural distinction is reflected in their evolutionary origins, as H3 and H4 receptors appear more closely related to peptide ligand GPCRs than to other biogenic amine receptors including H1 and H2 .

The receptor is a 7-transmembrane G-protein-coupled receptor with a total length of 390 amino acids in humans. The protein sequence contains specific domains critical for ligand binding and signal transduction that contribute to its unique pharmacological profile .

What are the primary signaling pathways associated with HRH4 activation?

HRH4 activation initiates several distinct signaling cascades that mediate its biological effects:

  • G-protein-mediated signaling: Upon histamine binding, HRH4 primarily couples to Gi/o proteins, leading to inhibition of adenylyl cyclase and subsequent reduction in intracellular cAMP levels. This mechanism has been demonstrated in steroidogenic cells, where HRH4 agonists inhibit LH/hCG-induced cAMP production .

  • Calcium mobilization: HRH4 activation triggers intracellular Ca2+ mobilization in several cell types, particularly in murine mast cells, which contributes to cellular responses without affecting degranulation .

  • Chemotactic signaling: A critical pathway involves the βγ subunit of G-proteins acting on phospholipase C to cause actin polymerization, ultimately leading to chemotaxis of immune cells. This mechanism is particularly important for mast cell and eosinophil recruitment in inflammatory settings .

  • MAPK pathway modulation: Evidence suggests HRH4 can influence MAP kinase signaling, affecting cell proliferation and differentiation processes. In Leydig tumor cells, HRH4 agonists inhibit cell proliferation, suggesting involvement in growth regulatory pathways .

  • Cytokine production regulation: HRH4 signaling modulates the production of inflammatory mediators, including IL-6 and VEGF, which has implications for conditions like diabetic retinopathy .

These signaling pathways collectively contribute to HRH4's role in immune cell chemotaxis, inflammatory responses, and tissue-specific functions such as steroidogenesis in testicular cells.

What are optimal cellular models for studying recombinant HRH4?

Several experimental models have proven valuable for investigating HRH4 function:

Cell/Tissue ModelApplicationAdvantagesLimitations
Bone marrow-derived macrophages (BMDMs)Chemotaxis assays, HRH4 regulation studiesPhysiological relevance, high expressionVariable primary cell preparations
MA-10 Leydig tumor cellsSteroidogenesis, proliferation studiesEndogenous HRH4 expression, well-characterizedTumoral origin may not reflect normal physiology
Primary Leydig cellsPhysiological regulation studiesNormal cell physiologyLimited availability, short culture lifespan
Transfected cell lines (HEK293, CHO)Pharmacological screeningHigh expression levels, reproducibilityMay lack relevant signaling components

Bone marrow-derived macrophages (BMDMs) represent an excellent primary cell model for studying HRH4 function in immune cells. These cells upregulate HRH4 expression when exposed to high glucose (25 mM) for 48 hours, making them particularly useful for investigating HRH4's role in metabolic inflammatory conditions . The macrophage model allows for assessment of chemotaxis, cytokine production, and receptor regulation under various inflammatory stimuli.

MA-10 Leydig tumor cells have been used effectively to study HRH4's role in steroidogenesis and cell proliferation. These cells express functional HRH4 that can be detected by immunofluorescence techniques and respond to HRH4 agonists with inhibition of LH/hCG-induced steroidogenic activity . Primary cultures of progenitor and immature rat Leydig cells provide complementary non-tumoral models that have demonstrated susceptibility to the anti-proliferative effects of HRH4 agonists .

For high-throughput pharmacological studies, recombinant expression systems using HEK293 or CHO cells transfected with human HRH4 enable detailed characterization of receptor-ligand interactions, though these systems may lack the full complement of physiologically relevant signaling components.

What methodologies are effective for measuring HRH4 activity?

Researchers can employ several complementary techniques to assess HRH4 activity:

  • Chemotaxis assays: Migration assays using Boyden chambers or transwell systems provide functional readouts of HRH4 activation in immune cells. For example, histamine-induced chemotaxis of macrophages can be measured and the specific contribution of HRH4 confirmed using selective antagonists like JNJ7777120 (JNJ) .

  • cAMP determination: Since HRH4 couples to Gi/o proteins, measuring the inhibition of adenylyl cyclase activity provides a direct assessment of receptor activation. Techniques include radioimmunoassays for cAMP or reporter gene assays with cAMP-responsive elements .

  • Calcium mobilization: Fluorescent calcium indicators can detect intracellular calcium flux following HRH4 activation, particularly in mast cells and other immune cells .

  • Protein expression analysis: Western blotting for downstream signaling molecules like StAR protein has been used to evaluate HRH4's impact on steroidogenesis in Leydig cells .

  • Proliferation assays: [3H]-thymidine incorporation assays have successfully demonstrated the antiproliferative effects of HRH4 agonists on both tumoral and normal Leydig cells .

  • Gene expression studies: RT-PCR and RNA sequencing can detect changes in HRH4 expression under different conditions, such as the upregulation observed in macrophages exposed to high glucose .

For confirming specificity, parallel experiments with selective HRH4 antagonists are essential, as is the inclusion of appropriate controls for other histamine receptor subtypes.

What are the most selective pharmacological tools for studying HRH4?

Several compounds have emerged as valuable tools for investigating HRH4 function:

CompoundTypeSelectivityApplicationsNotes
JNJ7777120 (JNJ)AntagonistHighly selectiveInhibition studies, validation of HRH4-mediated effectsShort half-life; minimal cross-reactivity with other histamine receptors
VUF 8430AgonistSelective for HRH4Activation studiesUsed in Leydig cell proliferation studies
ClobenpropitDual H3/H4 antagonistModerate selectivityComparative studiesUseful for distinguishing H3 vs. H4 effects

JNJ7777120 (JNJ) represents one of the most valuable pharmacological tools as a highly selective HRH4 antagonist with minimal cross-reactivity to other histamine receptors . This compound effectively blocks histamine-induced chemotaxis in macrophages and has demonstrated therapeutic potential in various disease models, including diabetic retinopathy. Its relatively short half-life should be considered when designing experimental protocols, often necessitating daily administration in in vivo studies.

VUF 8430 has been employed as a selective HRH4 agonist in studies examining the receptor's role in testicular function, where it was shown to inhibit steroidogenesis and proliferation in Leydig cells . When designing experiments with these compounds, researchers should include appropriate controls to confirm specificity, such as testing effects in HRH4-knockout models or in cells where the receptor has been silenced via RNA interference.

For comprehensive pharmacological characterization, concentration-response studies are essential, as is consideration of potential species differences in receptor pharmacology, which may complicate translation between animal models and human applications.

How does HRH4 modulate macrophage function in inflammatory conditions?

HRH4 plays a critical role in regulating macrophage behavior during inflammatory conditions, particularly in metabolic diseases such as diabetic retinopathy (DR):

  • Glucose-dependent regulation: High glucose environments (25 mM) significantly upregulate HRH4 expression in bone marrow-derived macrophages compared to normal glucose conditions (5 mM), suggesting a specific link between metabolic stress and HRH4 function .

  • Chemotactic mechanism: HRH4 mediates histamine-induced macrophage chemotaxis, particularly in cells exposed to high glucose. This chemotactic response can be effectively blocked by selective HRH4 antagonists like JNJ7777120, indicating a direct role for HRH4 in immune cell recruitment to inflammatory sites .

  • Inflammatory mediator production: Macrophages expressing HRH4 secrete inflammatory cytokines and growth factors, including IL-6 and VEGF, which contribute to vascular pathology in conditions like diabetic retinopathy .

  • Tissue infiltration control: In a streptozotocin-induced diabetic retinopathy mouse model, administration of JNJ7777120 reduced macrophage infiltration into retinal tissue, subsequently decreasing inflammatory responses and vascular permeability .

The experimental evidence strongly suggests that targeting HRH4 could modulate macrophage-driven inflammation. In diabetic retinopathy studies, HRH4 appears to be highly expressed in retinal macrophages but not in T cells, suggesting cell-type specificity that could be exploited therapeutically . This selective expression pattern offers the potential for targeted interventions that might minimize off-target effects on other immune cell populations.

What is the role of HRH4 in steroidogenesis and cell proliferation?

Research on testicular cells has revealed unexpected functions of HRH4 beyond the immune system:

  • Steroidogenic regulation: Functional HRH4 expression has been demonstrated in MA-10 Leydig tumor cells, where receptor activation inhibits LH/hCG-induced cAMP production and StAR protein expression, key components of the steroidogenic pathway .

  • Antiproliferative effects: HRH4 agonist treatment inhibits proliferation in both MA-10 Leydig tumor cells and normal progenitor and immature rat Leydig cells, suggesting a conserved growth regulatory function across normal and tumoral contexts .

  • Developmental expression pattern: Immunohistochemical studies have detected HRH4 in Leydig cells from rats of various ages (7-240 days), indicating potential roles throughout testicular development. Additionally, 21-day-old rats showed HRH4 expression within seminiferous tubules in male gametes, suggesting functions in germ cell development or maturation .

These findings reveal unexpected sites of functional HRH4 expression with potential implications for reproductive physiology and pathology. The dual effects on steroidogenesis and proliferation suggest HRH4 may serve as an endogenous regulator of testicular function, potentially responding to local histamine production within the reproductive tract.

This research highlights important considerations for the development of HRH4-targeted therapeutics, as systemic administration of HRH4 agonists might have unintended consequences on steroid hormone production or reproductive cell proliferation that should be carefully evaluated during drug development .

How do HRH4 polymorphisms influence disease susceptibility?

Genetic variations in the HRH4 gene have been associated with disease susceptibility, particularly in inflammatory conditions:

  • Asthma endophenotypes: Several single nucleotide polymorphisms (SNPs) in the HRH4 gene have shown significant associations with specific asthma characteristics, particularly infection-induced asthma .

  • Key polymorphisms: Three specific HRH4 SNPs have demonstrated significant associations with infection-induced asthma:

    • rs17187619: p = 0.002; odds ratio (OR) = 2.4 (95% CI: 4.1-1.4)

    • rs527790: p = 0.0002; OR = 3.3 (95% CI: 6.1-1.8)

    • rs487202: p = 0.00007; OR = 3.5 (95% CI: 6.6-1.9)

  • Haplotype associations: Specific haplotypes containing the rs4800573-rs527790 CC allele combination were found to be associated with infection-induced asthma (p = 0.0009, OR = 0.5, 95% CI: 0.4-0.8). Additionally, the rs487202-rs574913 CA haplotype was more frequent among patients with infection-induced asthma (p = 0.0006, OR = 1.9, 95% CI: 1.3-2.6) .

  • Functional implications: While these genetic associations have been established, research is still needed to determine the functional consequences of these polymorphisms on receptor expression, binding affinity, or signaling efficiency.

These findings suggest that genetic variation in HRH4 may contribute to individual differences in inflammatory disease susceptibility and potentially treatment response. For researchers, these polymorphisms may serve as important variables to consider when designing clinical studies or interpreting heterogeneous responses to HRH4-targeted therapeutics. Future studies should aim to characterize the functional impact of these genetic variants on receptor biology and explore potential genotype-guided therapeutic approaches.

What are the current limitations in HRH4-targeted therapeutics?

Despite promising preclinical results, several challenges remain in developing effective HRH4-targeted therapeutics:

  • Pharmacokinetic limitations: Current HRH4 antagonists like JNJ7777120 have relatively short half-lives, necessitating frequent dosing regimens. In animal studies, this has influenced administration protocols, with daily dosing required for sustained effects .

  • Selective targeting challenges: While HRH4 appears predominantly expressed on immune cells, its expression in other tissues (such as testicular cells) raises concerns about potential off-target effects of systemic HRH4 modulators .

  • Interspecies differences: There are notable variations in HRH4 pharmacology between species, which complicate the translation of preclinical findings to human applications. These differences need to be carefully addressed and taken into consideration during drug development .

  • Genetic polymorphisms: The influence of HRH4 genetic variants on receptor function and therapeutic response represents an additional layer of complexity. Individual variations in receptor genetics may affect drug efficacy and require personalized therapeutic approaches .

  • Limited clinical validation: Despite extensive preclinical evidence supporting HRH4 as a therapeutic target, human clinical validation remains limited for many proposed indications, necessitating further translational research.

Addressing these challenges will require multifaceted approaches, including the development of new HRH4 modulators with improved pharmacokinetic properties, targeted delivery systems to minimize off-target effects, and increased attention to the role of genetic variation in determining therapeutic outcomes.

How might HRH4 antagonism be applied in diabetic retinopathy?

Research on HRH4's role in diabetic retinopathy (DR) has revealed promising therapeutic applications:

These findings suggest development pathways for HRH4 antagonists as oral medications for preventative treatment of diabetic retinopathy, potentially benefiting diabetes patients before retinal complications manifest. Future research should focus on optimizing dosing regimens, exploring sustained-release formulations, and conducting longer-term studies to determine the durability of protective effects.

What novel methodological approaches are enhancing HRH4 research?

Emerging methodologies are advancing our understanding of HRH4 biology and therapeutic potential:

  • Structural biology approaches: Recent advances in determining the three-dimensional structure of HRH4 and its ligand binding sites are providing crucial insights for rational drug design. These structural studies enable more precise development of selective agonists and antagonists .

  • Genetic engineering techniques: CRISPR/Cas9 gene editing allows for precise manipulation of HRH4 sequences, facilitating the study of specific polymorphisms and their functional consequences. This approach enables the creation of cellular and animal models with human-relevant HRH4 variants.

  • Single-cell analysis: Application of single-cell RNA sequencing and proteomics to immune cell populations is revealing unprecedented detail about HRH4 expression patterns in specific cell subsets and disease states, moving beyond the limitations of bulk tissue analysis.

  • In vivo imaging: Development of PET tracers and other molecular imaging approaches specific for HRH4 offers the potential to visualize receptor distribution and occupancy in living subjects, bridging the gap between in vitro pharmacology and clinical effects.

  • Computational modeling: Machine learning and artificial intelligence approaches are being applied to predict HRH4-ligand interactions, optimize drug candidates, and identify patterns in genetic association data that may not be apparent through conventional statistical analysis.

These methodological advances collectively promise to accelerate progress in understanding HRH4 biology and developing targeted therapeutics. Integration of structural insights with functional and genetic data provides a more comprehensive foundation for translational research in this field.

What are the implications of HRH4 in non-allergic inflammatory conditions?

Beyond its established roles in allergic inflammation, HRH4 demonstrates significant involvement in various non-allergic inflammatory conditions:

  • Autoimmune diseases: Evidence suggests HRH4 participates in the pathogenesis of autoimmune disorders through modulation of dendritic cell function and T cell differentiation. HRH4 influences dendritic cell activation and CD4+ T cell responses, potentially contributing to dysregulated immune responses in conditions like rheumatoid arthritis .

  • Chronic pruritus: HRH4 has emerged as a promising target for treating chronic itching conditions that may be resistant to traditional antihistamines targeting H1 receptors. The distinct signaling pathways of HRH4 may offer therapeutic advantages in these challenging clinical scenarios .

  • Diabetic complications: Recent research has established HRH4's role in diabetic retinopathy through regulation of macrophage infiltration and inflammatory mediator production. This suggests potential involvement in other diabetes-related complications characterized by chronic inflammation .

  • Neuroimmune interactions: HRH4 expression in specific brain regions (cerebellum and hippocampus) raises intriguing questions about potential roles in neuroimmune communication and neuroinflammatory conditions that warrant further investigation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.