Recombinant Human Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Homocysteine-Responsive Endoplasmic Reticulum-Resident Ubiquitin-Like Domain Member 1 Protein (HERPUD1)

Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, known as HERPUD1, is a protein encoded by the HERPUD1 gene in humans . HERPUD1 is a key component of the endoplasmic reticulum (ER) protein quality control mechanism . It is involved in ER-associated degradation (ERAD), which is an ER-resident protein quality control mechanism . HERPUD1 may play a role in both the unfolded protein response (UPR) and ERAD .

HERPUD1 and its Role in Cellular Processes

HERPUD1 functions as one of the main components of ER-associated degradation, which is an ER-resident protein quality mechanism . HERPUD1 is upregulated under ER stress, a condition reported to cause ER membrane expansion and remodeling . It has been shown that HERPUD1 regulates ERAD by interacting with proteins involved in the retrotranslocation, ubiquitination, and degradation of misfolded proteins . HERPUD1 is one of the critical components involved in stabilizing the ERAD multiprotein complex and effectively directs misfolded proteins to degradation and is thought to be one of the major components of ERAD .

HERPUD1 has been proposed as one of the significant components of ERAD, which acts as a structure-scaffolding protein in the ER membrane . It acts as a shuttle protein in the retrotranslocation step of ERAD and has no known enzyme activity . Moreover, HERPUD1 controls the proteasomal degradation of the inositol 1,4,5-triphosphate receptor and ryanodine receptor proteins, which is a $$Ca^{+2}$$ channel and has a critical role in $$Ca^{+2}$$ homeostasis .

HERPUD1 is necessary for adequate insulin-induced glucose uptake due to its role in $$Ca^{2+}$$/calcineurin regulation in L6 myotubes .

HERPUD1 and ER Stress Response

The accumulation of unfolded proteins in the endoplasmic reticulum (ER) triggers the ER stress response . This response includes the inhibition of translation to prevent further accumulation of unfolded proteins, the increased expression of proteins involved in polypeptide folding, known as the unfolded protein response (UPR), and the destruction of misfolded proteins by the ER-associated protein degradation (ERAD) system . HERPUD1's expression is induced by UPR, and it has an ER stress response element in its promoter region . The encoded protein has an N-terminal ubiquitin-like domain which may interact with the ERAD system .

HERPUD1 Interactions

HERPUD1 interacts in the ER membrane with Hrd1/SYVN1, an E3 ligase enzyme responsible for protein ubiquitination required to target misfolded proteins to proteasomal degradation, ubiquitin molecule, adaptor subunit SEL1L, OS-9 acting as a lectin, and Derlin1, which is proposed as a component of the channel complex . HERPUD1 has been shown to interact with UBQLN1 and UBQLN2 .

HERPUD1 and Cancer

HERPUD1 functions as one of the main components of the ER protein quality control mechanism, which has been recommended as a good target for the treatment of many cancer types . HERPUD1 may be a good target for suppressing tumorigenesis in breast cancer cells .

HERPUD1 and Cardiac Hypertrophy

HERPUD1 plays a significant role in the regulation of $$Ca^{2+}$$ levels, possibly by modulating IP3R degradation . Herpud1 plays a significant role in the regulation of $$Ca^{2+}$$ levels and has a potential role in anti-hypertrophic mechanisms .

HERPUD1 and Macroautophagy

Stabilized HERPUD1 downregulates macroautophagy, favoring instead a closed interplay between the ER and lysosomes with consequences in drug-cell . Stabilized HERPUD1 through the deletion of its UBL domain causes a decrease in basal and induced autophagy . Additionally, it promotes an ER remodeling independent of the unfolded protein response activation into stacked tubular structures resembling previously described tubular ER rearrangements . Higher HERPUD1 stability has a positive impact in lysosomal function, promoting an expanded ER-lysosomal network . The phosphomimetic S59D mutant within the UBL domain of HERPUD1 mimics the effect of the UBL deletion and reduces basal and induced autophagy and remodeling of the ER-lysosomal network with the presence of ER-lysosomal membrane-contact sites, together promoting drug-stress cell survival .

HERPUD1 Antibody Information

ANTIBODY INFORMATIONDETAILS
ReactivityHuman, Mouse, Rat, Monkey
SensitivityEndogenous
Molecular Weight54 kDa
SourceRabbit
ApplicationWestern Blotting (1:1000 dilution)
BackgroundMay act as a molecular adaptor for the recruitment of ERAD machinery; the amino-terminal UBL domain may be important for this function

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HERPUD1; HERP; KIAA0025; MIF1; Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein; Methyl methanesulfonate; MMF-inducible fragment protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-391
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MESETEPEPVTLLVKSPNQRHRDLELSGDRGWSVGHLKAHLSRVYPERPRPEDQRLIYSG KLLLDHQCLRDLLPKQEKRHVLHLVCNVKSPSKMPEINAKVAESTEEPAGSNRGQYPEDS SSDGLRQREVLRNLSSPGWENISRPEAAQQAFQGLGPGFSGYTPYGWLQLSWFQQIYARQ YYMQYLAATAASGAFVPPPSAQEIPVVSAPAPAPIHNQFPAENQPANQNAAPQVVVNPGA NQNLRMNAQGGPIVEEDDEINRDWLDWTYSAATFSVFLSILYFYSSLSRFLMVMGATVVM YLHHVGWFPFRPRPVQNFPNDGPPPDVVNQDPNNNLQEGTDPETEDPNHLPPDRDVLDGE QTSPSFMSTAWLVFKTFFASLLPEGPPAIAN
Uniprot No.

Target Background

Function
Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 (HERPUD1) is a component of the endoplasmic reticulum quality control (ERQC) system, also known as ER-associated degradation (ERAD). It participates in the ubiquitin-dependent degradation of misfolded endoplasmic reticulum proteins and may enhance presenilin-mediated amyloid-beta protein 40 generation. HERPUD1 interacts with ubiquilins, an interaction crucial for efficient CD3D degradation via the ERAD pathway.
Gene References Into Functions
  1. Synoviolin regulates HERP stability through lysine ubiquitination-independent proteasomal degradation. PMID: 29863080
  2. HERP plays a key role in regulating host innate immunity in response to ER stress during RNA virus infection. PMID: 28954889
  3. Low miR-9-3p expression leads to high Herpud1 levels, potentially protecting against glioma apoptosis. PMID: 28430789
  4. NQO1 stabilizes Herp protein expression through indirect synoviolin regulation. PMID: 27084451
  5. The CREB3/Herp pathway limits cytosolic Ca2+ increase and apoptosis early in poliovirus infection, potentially mitigating central nervous system damage during poliomyelitis. PMID: 27405867
  6. HERPUD1 SNPs are strongly associated with polypoidal choroidal vasculopathy. PMID: 26823705
  7. The cytoprotective effect of HERPUD1 against oxidative stress depends on ITPR and Ca(2+) transfer from the endoplasmic reticulum to mitochondria. PMID: 26616647
  8. Nrf1 is a transcriptional activator of Herpud1 expression during ER stress, playing a key role in the ER stress response. PMID: 25637874
  9. Herp is a key factor in defending against glucose starvation by modulating autophagy levels. PMID: 24120520
  10. Increased MIF and MMP9 co-expression in tumors, along with histological grade, may predict recurrence, especially in benign meningiomas. PMID: 23372434
  11. Herp binding to Hrd1-containing ERAD complexes positively regulates ubiquitylation, promoting cell survival during ER stress. PMID: 21149444
  12. Herp may delay cytosolic protein degradation at the ubiquitination step. PMID: 20604806
  13. Herp's structural similarity to DNA makes it a potential autoantigen for anti-DNA antibodies. PMID: 20147634
  14. 4-trifluoromethyl-celecoxib inhibits IL-12 and IL-23 secretion (but not transcription), potentially through HERP's ER function. PMID: 20054003
  15. Herp enhances presenilin-mediated amyloid-beta protein generation. PMID: 11799129
  16. Herp expression is upregulated by Wnt-1. PMID: 12153396
  17. Herp's ubiquitin-like domain may associate with the 26S proteasome, linking protein degradation to the ER membrane for efficient ERAD. PMID: 12370023
  18. Herp's ubiquitin-like domain likely regulates its intracellular levels under ER stress. PMID: 14550564
  19. Herp, involved in ERAD, is a direct target of Luman. PMID: 16940180
  20. The AARE (amino acid response element) and CREB binding site are involved in Herp induction. PMID: 17020760
  21. Herp complexes with ubiquitinated proteins and the 26S proteasome, linking substrates to the proteasome. PMID: 18042451
  22. Herp binding to ubiquilin proteins is crucial for the ERAD pathway; ubiquilins are involved in degrading a subset of ubiquitinated targets, including Herp-dependent substrates. PMID: 18307982
  23. Type II alcoholic patients show significantly higher Herp mRNA expression due to ethanol's upregulation of this neuroprotective protein. PMID: 19251110
  24. Understanding how Herp counteracts Ca(2+) disturbances will provide insights into dopaminergic neuron cell death. PMID: 19447887
  25. Herp may initiate inflammation-like changes in Parkinson's disease substantia nigra, linking degeneration and neuroinflammation. PMID: 19788048
  26. Herp protein expression is upregulated in response to ER stress, including homocysteine. PMID: 17020760
Database Links

HGNC: 13744

OMIM: 608070

KEGG: hsa:9709

STRING: 9606.ENSP00000409555

UniGene: Hs.146393

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed; in the brain, expression seems to be restricted to neurons and vascular smooth muscle cells. Present in activated microglia in senile plaques in the brain of patients with Alzheimer disease.

Q&A

What is the fundamental role of HERPUD1 in cellular homeostasis?

HERPUD1 functions as an essential component of the endoplasmic reticulum-associated degradation (ERAD) complex, which is responsible for identifying, ubiquitinating, and eliminating misfolded proteins from the ER. It specifically participates in IP3R1 (inositol 1,4,5-trisphosphate receptor) degradation and calcium signaling regulation, making it a critical factor in maintaining cellular calcium homeostasis . HERPUD1 acts as a scaffold protein that helps organize functional retrotranslocation complexes in HRD1-mediated ERAD, facilitating the recruitment of other components necessary for the ERAD machinery to function properly .

What are the key structural domains of HERPUD1 protein?

HERPUD1 contains several functionally distinct domains that contribute to its role in ERAD:

  • A ubiquitin-like (UBL) domain at the N-terminus, which is critical for its function in the ERAD pathway

  • A long hydrophobic segment near the C-terminal region that facilitates membrane association

  • A cytosolic region that mediates interaction with HRD1

Unlike its yeast homolog Usa1p, HERPUD1 does not regulate HRD1 stability or oligomerization status, but instead helps recruit DERL2 to the HRD1-SEL1L complex, highlighting evolutionary divergence in function .

How is HERPUD1 expression regulated under different cellular stress conditions?

HERPUD1 expression is significantly upregulated in response to various cellular stressors. Experimental data shows:

  • Treatment with tunicamycin (10μg/ml for 12h), an ER stress inducer, increases HERPUD1 protein levels by approximately 6.5-fold (p<0.05) in cultured neonatal rat ventricular myocytes (NRVMs)

  • Oxidative stress induced by H₂O₂ (100μM for 2h) increases HERPUD1 protein levels by about 1.3-fold (p<0.05) in NRVMs

This stress-responsive upregulation suggests HERPUD1 is part of an adaptive cellular mechanism to protect against various forms of cellular stress, particularly in cardiac tissue.

What experimental models are most appropriate for studying HERPUD1 function?

Based on the latest research, several experimental models have proven effective for HERPUD1 research:

  • Genetic knockout models: Herpud1-knockout mice exhibit cardiac hypertrophy and dysfunction, making them an excellent model for studying HERPUD1's role in cardiac pathophysiology

  • Cell culture systems:

    • Neonatal rat ventricular myocytes (NRVMs) with siRNA-mediated HERPUD1 knockdown (NRVMs-H(-))

    • 293T cells for protein interaction studies and characterization of the HRD1-SEL1L-DERL2 complex

  • Stress induction models:

    • Tunicamycin treatment (10μg/ml) to induce ER stress

    • H₂O₂ treatment (100μM) to induce oxidative stress

These models allow for comprehensive assessment of HERPUD1 function in both physiological and pathological contexts.

What methodologies are most effective for analyzing HERPUD1 protein-protein interactions?

Several complementary techniques have proven valuable for studying HERPUD1 interactions:

  • Co-immunoprecipitation: Highly effective for identifying components of the HERPUD1-containing complexes. Using HRD1 antibodies, researchers have successfully co-precipitated endogenous SEL1L, DERL2, HERP1, and HERP2, confirming that HERPUD1 is part of the HRD1-SEL1L-DERL2 complex

  • FLAG-tag immunoprecipitation: Expression of FLAG-tagged HERP1 or HERP2 followed by immunoprecipitation with FLAG antibodies can be used to study interactions with HRD1, SEL1L, and DERL2

  • RNA interference combined with biochemical analysis: Depleting HERP1 and/or HERP2 via siRNA followed by analysis of substrate degradation provides insights into functional roles within the ERAD complex

These methods have revealed that HERP1 and HERP2 can form hetero-oligomers either directly or through the HRD1 complex, suggesting functional redundancy .

How does HERPUD1 regulate cardiac hypertrophy at the molecular level?

HERPUD1 functions as a negative regulator of pathological cardiac hypertrophy primarily through its regulation of IP3R protein levels. The mechanistic pathway involves:

  • HERPUD1 facilitates the degradation of IP3R through the ERAD pathway

  • In the absence of HERPUD1 (knockout mice or siRNA-treated cardiomyocytes), IP3R levels become elevated

  • Elevated IP3R leads to increased cytosolic and nuclear Ca²⁺ levels

  • Altered calcium signaling activates hypertrophic pathways

  • This results in increased expression of hypertrophic markers and development of pathological cardiac hypertrophy

This mechanism establishes HERPUD1 as a novel regulator of cardiac pathophysiology through its effects on calcium homeostasis.

What is the relationship between HERPUD1, ER stress, and mitochondrial dysfunction in cardiomyocytes?

HERPUD1 plays a protective role against both ER stress and oxidative stress in cardiomyocytes. Experimental evidence demonstrates:

  • Downregulation of HERPUD1 by siRNA in NRVMs exacerbates ER stress markers:

    • Increased CHOP (1.2-fold, p<0.05)

    • Increased BiP (1.4-fold, p<0.05)

    • Elevated cleaved caspase-9 (2.0-fold, p<0.05)

    • Elevated cleaved caspase-3 (1.3-fold, p<0.05)

  • HERPUD1 knockdown significantly impairs mitochondrial function:

    • Decreased mitochondrial oxygen consumption rate (OCR) (0.5-fold, p<0.05)

    • Reduced cell viability (0.7-fold, p<0.05) after tunicamycin treatment

  • Under oxidative stress conditions (H₂O₂ treatment), HERPUD1 downregulation results in:

    • Increased ER stress markers (CHOP, PERK)

    • Enhanced apoptotic signaling (cleaved caspase-9, cleaved caspase-3)

    • Further decreased cell viability (0.8-fold, p<0.05)

These findings establish HERPUD1 as a critical protective factor against stress-induced cardiac injury and mitochondrial dysfunction.

How does HERPUD1 interact with the HRD1-SEL1L complex in the ERAD pathway?

HERPUD1 serves as an essential adaptor protein in the HRD1-mediated ERAD pathway. Key findings regarding this interaction include:

  • HERPUD1 interacts with HRD1 through a region located in the cytosol

  • Unlike its yeast homolog (Usa1p), HERPUD1 does not regulate HRD1 stability or oligomerization status

  • HERPUD1 helps recruit DERL2 to the HRD1-SEL1L complex, which is critical for forming an active retrotranslocation complex

  • The UBL domain of HERPUD1 has functions independent of DERL2 recruitment in ERAD

  • Both HERPUD1 and HERPUD2 can co-exist in the same HRD1-SEL1L complex, suggesting potential functional redundancy or cooperation

Immunoprecipitation experiments confirm that endogenous SEL1L, DERL2, HERP1, and HERP2 can be co-precipitated with HRD1, indicating that they form part of the same multi-protein complex in mammalian cells .

What is the functional relationship between HERPUD1 and HERPUD2?

HERPUD1 and HERPUD2 share significant structural and functional similarities:

  • Sequence homology: HERPUD2 shares 38% sequence identity and 51% homology with HERPUD1

  • Domain structure: Similar to HERPUD1, HERPUD2 contains a ubiquitin-like (UBL) domain at the N terminus and a long hydrophobic segment near the C-terminal region

  • Functional redundancy: Experimental evidence shows that:

    • Depletion of either HERPUD1 or HERPUD2 individually does not cause significant stabilization of certain ERAD substrates (e.g., SHH N278A)

    • Simultaneous depletion of both HERP proteins results in strong inhibition of substrate degradation

    • Both proteins can form hetero-oligomers either directly or through the HRD1 complex

This partial functional redundancy explains why some ERAD substrates are only significantly stabilized when both HERP proteins are depleted, suggesting an evolved safeguard mechanism for this critical cellular quality control system.

What are the optimal conditions for working with recombinant HERPUD1 protein in experimental settings?

When working with recombinant HERPUD1 protein, researchers should consider:

  • Expression systems: Human cell lines (particularly 293T cells) have been successfully used to express HERPUD1 proteins with epitope tags (such as FLAG)

  • Protein solubilization: Given HERPUD1's membrane association, appropriate detergent conditions must be optimized for extraction while maintaining protein-protein interactions

  • Buffer considerations: When studying interactions with other ERAD components, buffers that preserve membrane protein complexes are essential

  • Tag selection: His-tagged versions of HERPUD1 (such as AA 1-263) are commercially available and have been used in research applications

  • Functional validation: Assessment of recombinant HERPUD1 activity can be performed through its ability to bind known interaction partners (HRD1, DERL2) and/or complement HERPUD1-deficient cell lines

What techniques can be used to study the role of HERPUD1 in substrate recognition and processing?

Several complementary approaches can be employed:

  • Substrate stabilization assays: Using model ERAD substrates like SHH (Sonic Hedgehog) and NHK (Null Hong Kong alpha-1-antitrypsin) in cells with HERPUD1 knockdown or knockout

  • Ubiquitination analysis: Assessing the ubiquitination status of ERAD substrates in the presence or absence of HERPUD1

  • Calcium signaling measurements: Given HERPUD1's role in IP3R regulation, measuring cytosolic and nuclear Ca²⁺ levels using appropriate indicators

  • Mitochondrial function assays: Oxygen consumption rate (OCR) measurements to assess how HERPUD1 affects mitochondrial function under stress conditions

  • Cell viability assays: Quantitative assessment of cell survival under various stress conditions with cell titer blue assay or similar methods

These methodologies provide comprehensive insights into HERPUD1's multifaceted roles in protein quality control and cellular stress responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.