Recombinant Human Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein (HERPUD2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
HERPUD2; Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-406
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
HERPUD2
Target Protein Sequence
MDQSGMEIPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPLTKDQRLVYSG RLLPDHLQLKDILRKQDEYHMVHLVCTSRTPPSSPKSSTNRESHEALASSSNSSSDHSGS TTPSSGQETLSLAVGSSSEGLRQRTLPQAQTDQAQSHQFPYVMQGNVDNQFPGQAAPPGF PVYPAFSPLQMLWWQQMYAHQYYMQYQAAVSAQATSNVNPTQPTTSQPLNLAHVPGEEPP PAPNLVAQENRPMNENVQMNAQGGPVLNEEDFNRDWLDWMYTFSRAAILLSIVYFYSSFS RFIMVMGAMLLVYLHQAGWFPFRQEGGHQQAPNNNAEVNNDGQNANNLELEEMERLMDDG LEDESGEDGGEDASAIQRPGLMASAWSFITTFFTSLIPEGPPQVAN
Uniprot No.

Target Background

Function
Potentially involved in the unfolded protein response (UPR) pathway.
Database Links

HGNC: 21915

KEGG: hsa:64224

STRING: 9606.ENSP00000310729

UniGene: Hs.643051

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is HERPUD2 and how does it differ from HERPUD1?

HERPUD2 is a homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein that shares approximately 38% sequence identity and 51% homology with HERPUD1 . Despite these similarities, HERPUD2 is constitutively expressed in cells, whereas HERPUD1 is highly induced by ER stress . This constitutive expression pattern suggests that HERPUD2 may serve as a basal maintenance component of the ERAD machinery, while HERPUD1 provides additional capacity during stress conditions.

Both proteins contain a ubiquitin-like (UBL) domain at their N-terminus and a long hydrophobic segment near their C-terminal region . The presence of these structural elements is crucial for their function in the ERAD pathway. They serve as integral components of the HRD1 complex, which is responsible for recognizing and targeting misfolded proteins for degradation.

What is the subcellular localization and membrane topology of HERPUD2?

HERPUD2 predominantly localizes to the endoplasmic reticulum membrane as demonstrated by immunofluorescence studies showing co-localization with the ER marker Sec61α-RFP . Cell fractionation experiments confirm that HERPUD2 is exclusively present in membrane fractions and not in cytosolic fractions .

Regarding membrane topology, HERPUD2 adopts a configuration where both its N-terminus and C-terminus are exposed to the cytosol. This was elegantly demonstrated using protease protection assays with N-terminally FLAG-tagged and C-terminally HA-tagged HERPUD2 . When membrane fractions containing tagged HERPUD2 were treated with proteinase K, both epitope tags became undetectable, indicating that both termini face the cytosolic side of the ER membrane . This topology is critical for its function in recruiting cytosolic components of the ERAD machinery.

Domain/RegionLocationFunction
Ubiquitin-like (UBL) domainN-terminusPotential role in protein interactions or recruitment of ERAD components
Hydrophobic segmentNear C-terminusMembrane integration
N-terminusCytosolic faceInteraction with cytosolic ERAD components
C-terminusCytosolic facePotential regulatory region

How does HERPUD2 contribute to the HRD1-mediated ERAD pathway?

HERPUD2 serves as an essential adaptor between HRD1 and DERL2, helping to organize a functional retrotranslocation complex in HRD1-mediated ERAD . Immunoprecipitation experiments have demonstrated that both HERPUD1 and HERPUD2 are integral components of the HRD1-SEL1L-DERL2 complex, suggesting their direct involvement in the retrotranslocation process .

When researchers depleted both HERPUD1 and HERPUD2 simultaneously, they observed significant stabilization of ERAD substrates, including glycosylated SHH-C (sonic hedgehog C-terminal fragment), non-glycosylated SHH variant (N278A), and NHK (null Hong Kong α1-antitrypsin) . This stabilization occurred because the misfolded proteins were trapped in the ER, indicating a defect in the retrotranslocation step of ERAD .

Interestingly, ubiquitination of SHH was significantly reduced in cells depleted of HERPUD proteins, further supporting their role in facilitating retrotranslocation prior to the ubiquitination step . This suggests that HERPUD2, in coordination with HERPUD1, helps position ERAD substrates for efficient ubiquitination by the HRD1 E3 ligase.

What is the molecular basis for HERPUD2's interaction with the HRD1 complex?

HERPUD2 interacts with the HRD1 complex through regions located in the cytosol . Co-immunoprecipitation experiments have confirmed that endogenous HERPUD2 can be pulled down with HRD1 antibodies, along with other components of the complex such as SEL1L and DERL2 . This interaction is specific, as control proteins like calnexin and BiP do not co-precipitate with HRD1 .

Interestingly, when FLAG-tagged HERPUD1 is immunoprecipitated, it can pull down endogenous HERPUD2, and vice versa . This suggests that HERPUD1 and HERPUD2 can form hetero-oligomers either directly or through their association with the HRD1 complex. These interactions likely contribute to the partial functional redundancy observed between HERPUD1 and HERPUD2 in ERAD.

The precise binding interface between HERPUD2 and HRD1 remains to be fully characterized, but it appears that recombinant HERPUD1 protein interacts with the RING domain of HRD1 . Given the homology between HERPUD1 and HERPUD2, a similar interaction might occur with HERPUD2, though this requires experimental confirmation.

What methods are effective for studying HERPUD2 function in ERAD?

To effectively study HERPUD2 function in ERAD, researchers can employ several complementary approaches:

  • RNA interference (siRNA): Depleting HERPUD2 using siRNA, either alone or in combination with HERPUD1 depletion, can reveal its role in ERAD. For example, researchers have used siRNA-mediated knockdown followed by cycloheximide chase experiments to examine the degradation kinetics of ERAD substrates . The siRNA sequences used for HERPUD2 depletion are documented in published protocols .

  • Cycloheximide chase assays: This method allows researchers to track the degradation of ERAD substrates over time in the presence or absence of HERPUD2. Following protein synthesis inhibition by cycloheximide, samples are collected at various time points and analyzed by immunoblotting to determine protein stability .

  • Co-immunoprecipitation: This technique is useful for investigating protein-protein interactions involving HERPUD2. Using antibodies against HERPUD2 or epitope tags (e.g., FLAG), researchers can precipitate HERPUD2 and identify its binding partners by immunoblotting .

  • Subcellular fractionation: Separating membrane and cytosolic fractions helps determine the localization of HERPUD2 and its association with membrane-bound complexes .

  • Protease protection assays: By treating membrane fractions with proteases like proteinase K, researchers can determine the membrane topology of HERPUD2 and identify which domains are accessible to the cytosol .

How can researchers distinguish between HERPUD1 and HERPUD2 functions?

Distinguishing between HERPUD1 and HERPUD2 functions requires strategic experimental approaches due to their partial functional redundancy. Here are effective methods:

  • Specific antibodies: Using antibodies that recognize either HERPUD1 or HERPUD2 without cross-reactivity is crucial. Studies have verified the specificity of HERPUD2 antibodies by immunoblotting, confirming they do not cross-react with HERPUD1 .

  • Selective depletion: Knocking down HERPUD1 or HERPUD2 individually allows researchers to assess their specific contributions. Combined knockdown can reveal redundant functions. Previous studies have shown that while individual depletion of either protein has minimal effects on ERAD, simultaneous depletion significantly impairs degradation of substrates like SHH-C and NHK .

  • Complementation experiments: After depleting endogenous HERPUD proteins, researchers can express siRNA-resistant versions of either HERPUD1 or HERPUD2 to determine if they can rescue the ERAD defect.

  • Stress conditions: Since HERPUD1 is highly induced during ER stress while HERPUD2 is constitutively expressed, comparing ERAD efficiency under normal and stress conditions can highlight their differential roles .

  • Domain swapping: Creating chimeric proteins by swapping domains between HERPUD1 and HERPUD2 can help identify which regions confer specific functional properties.

What expression systems are optimal for producing recombinant human HERPUD2?

When producing recombinant human HERPUD2, researchers should consider several expression systems based on experimental objectives:

  • Mammalian expression systems: Since HERPUD2 is a membrane protein with specific topology requirements, mammalian systems like HEK293T cells provide the most native environment for proper folding and post-translational modifications . These cells have been successfully used to express tagged versions of HERPUD2 for functional studies .

  • Baculovirus-insect cell systems: For higher yield while maintaining eukaryotic processing capabilities, insect cells can be employed. This system may be particularly useful for structural studies requiring larger protein amounts.

  • Cell-free expression systems: For rapid production of the cytosolic domains of HERPUD2, cell-free systems may be considered, though they lack the membrane environment needed for full-length protein.

  • Bacterial systems with membrane mimetics: For biochemical studies of specific domains, E. coli expression followed by reconstitution in membrane mimetics like nanodiscs or liposomes might be suitable.

For all systems, incorporating appropriate epitope tags (e.g., FLAG, HA) at either the N- or C-terminus facilitates purification and detection without interfering with function, as demonstrated in previous studies .

What are the critical quality control parameters for recombinant HERPUD2?

When producing recombinant HERPUD2, researchers should monitor several quality control parameters to ensure functionality:

  • Membrane integration: Since HERPUD2 is an integral membrane protein, confirming proper membrane integration is crucial. Cell fractionation followed by Western blotting can verify that recombinant HERPUD2 is present in membrane fractions rather than forming aggregates .

  • Correct topology: Protease protection assays similar to those used for endogenous HERPUD2 can confirm that recombinant protein adopts the correct membrane topology with both N- and C-termini exposed to the cytosol .

  • Protein-protein interactions: Functional recombinant HERPUD2 should maintain the ability to interact with HRD1, SEL1L, and DERL2. Co-immunoprecipitation experiments can verify these interactions .

  • ERAD substrate processing: The ultimate functional test for recombinant HERPUD2 is its ability to rescue ERAD defects in cells depleted of endogenous HERPUD proteins. Cycloheximide chase assays measuring degradation of model substrates like SHH-C or NHK can assess this capability .

  • Oligomerization state: Since HERPUD2 can form complexes with HERPUD1, analyzing the oligomerization state of recombinant HERPUD2 by methods such as size exclusion chromatography or native PAGE is advisable .

What considerations are important when analyzing HERPUD2 interaction data?

Analyzing protein interaction data for HERPUD2 requires careful consideration of several experimental factors:

  • Detergent selection: Since HERPUD2 is a membrane protein, the choice of detergent for solubilization can significantly affect observed interactions. Mild detergents that preserve membrane protein interactions should be preferred for co-immunoprecipitation studies .

  • Control for specificity: When performing co-immunoprecipitation experiments, appropriate negative controls (such as unrelated proteins like FLAG-WASP) should be included to confirm the specificity of observed interactions . Additionally, proteins that are not expected to interact with HERPUD2, such as calnexin or BiP, can serve as negative controls .

  • Direct versus indirect interactions: Co-immunoprecipitation alone cannot distinguish between direct and indirect interactions. For example, the observed interaction between HERPUD1 and HERPUD2 might be direct or mediated through the HRD1 complex . Additional techniques like proximity labeling or in vitro binding assays with purified components may be necessary to clarify the nature of interactions.

  • Quantitative analysis: Beyond qualitative detection of interactions, quantitative analysis of binding stoichiometry can provide insights into the composition and organization of the HRD1-HERPUD2 complex. Densitometric analysis of immunoblots can estimate relative proportions of interacting partners .

How can HERPUD2 research contribute to understanding ER stress-related diseases?

Research on HERPUD2 has significant implications for understanding diseases associated with ER stress and protein misfolding:

  • Neurodegenerative diseases: Many neurodegenerative disorders involve protein misfolding and ER stress. Given HERPUD2's role in ERAD and its constitutive expression pattern, it may serve as a critical quality control component that helps prevent accumulation of misfolded proteins associated with diseases like Alzheimer's and Parkinson's .

  • Cancer biology: Rapidly proliferating cancer cells often face ER stress due to increased protein synthesis demands. Understanding how HERPUD2 contributes to managing this stress could reveal potential therapeutic targets. The constitutive expression of HERPUD2 might make it a particularly important factor in cancer cell survival under basal conditions .

  • Genetic disorders involving protein misfolding: HERPUD2's involvement in degrading misfolded proteins like NHK (a mutant α1-antitrypsin associated with liver disease) suggests its relevance to genetic disorders characterized by protein misfolding . Enhancing HERPUD2 function might potentially alleviate the cellular burden of such misfolded proteins.

  • ER stress response modulation: While HERPUD1 is induced during ER stress, HERPUD2 maintains constitutive expression . This differential regulation might provide new insights into how cells modulate their ERAD capacity under various stress conditions, potentially offering new approaches for therapeutic intervention.

What are promising future directions for HERPUD2 research?

Several promising research directions could advance our understanding of HERPUD2 function and its potential applications:

  • Structural studies: Determining the three-dimensional structure of HERPUD2, particularly its UBL domain and membrane-spanning regions, would provide valuable insights into its mechanism of action and interaction with other ERAD components .

  • Substrate specificity: While HERPUD2 has been implicated in the degradation of several model ERAD substrates like SHH-C and NHK , a more comprehensive analysis of substrate specificity could reveal whether HERPUD2 plays selective roles in targeting specific classes of misfolded proteins.

  • Regulation mechanisms: Although HERPUD2 is constitutively expressed, investigating potential post-translational modifications or regulatory interactions could reveal how its activity is fine-tuned under different cellular conditions .

  • Comparative studies across species: Expanding studies of HERPUD2 across different model organisms could provide evolutionary insights. For instance, the zebrafish ortholog of HERPUD2 has been identified , offering opportunities for in vivo functional studies.

  • Therapeutic targeting: Developing methods to modulate HERPUD2 function could have therapeutic potential for diseases associated with protein misfolding. Since HERPUD2 is constitutively expressed, it might serve as a more stable target compared to stress-induced factors .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.