Recombinant Human Hyaluronan synthase 1 (HAS1)

Shipped with Ice Packs
In Stock

Description

Protein Structure

HAS1 is a membrane-bound enzyme with a molecular weight of 34.4 kDa (calculated) and 33 kDa (observed) . It contains a single transmembrane domain and catalytic motifs for HA synthesis. Recombinant versions are often truncated or tagged for purification:

  • Full-length: 577 amino acids (e.g., HAS1-3483HF)

  • Common fragments: Tyr160-Ala416 (e.g., HAS1-2229H) , Tyr164-Ala421

  • Tags: His, GST, or Myc for purification and detection

ParameterValueSource
Molecular Weight33–34.4 kDa
Host SystemsE. coli, S. cerevisiae, Wheat Germ, Mammalian Cells
Key TagsHis, GST, Myc

Production and Expression Systems

Recombinant HAS1 is produced in diverse hosts to optimize yield and post-translational modifications:

HostTagProtein LengthApplication
E. coliHisTyr160-Ala416Western Blot, SDS-PAGE
S. cerevisiaeHisMet1-Val583Structural studies
Wheat GermGSTFull-length (577 aa)Enzyme activity assays
Mammalian CellsHisFull-lengthLive-cell imaging

Key challenges:

  • Low enzymatic activity under standard conditions due to high UDP-sugar requirements .

  • Substrate dependence: Requires elevated UDP-glucuronic acid (UDP-GlcUA) and UDP-N-acetylglucosamine (UDP-GlcNAc) for activation .

Hyaluronan Synthesis Mechanism

HAS1 polymerizes UDP-GlcUA and UDP-GlcNAc into HA via alternating β-1,3 and β-1,4 glycosidic bonds. Its activity is distinct from HAS2 and HAS3:

IsoformK<sub>m</sub> (UDP-GlcUA)K<sub>m</sub> (UDP-GlcNAc)V<sub>max</sub> (HA Synthesis)
HAS1~0.74 mM~1.5 mMModerate
HAS2~0.32 mM~0.74 mMHigh
HAS3~0.32 mM~0.74 mMVery High

Data derived from kinetic studies in COS-1 cells .

Regulation and Substrate Dependency

HAS1 activity is induced by:

  • Pro-inflammatory cytokines: IL-1β, TNF-α .

  • Hyperglycemic conditions: Elevated UDP-sugar levels .

  • Glycosamine supplementation: Increases cellular UDP-GlcNAc, enhancing HA production .

Cellular and Molecular Roles

HAS1 contributes to:

  • Inflammation: Upregulated in atherosclerosis, osteoarthritis, and lung infections .

  • Cancer: Overexpressed in breast, prostate, and mesothelioma cancers; correlates with poor prognosis .

  • Wound Healing: Provides a scaffold for fibroblast and endothelial cell migration .

Pathway Interactions

HAS1 interacts with proteins in:

PathwayAssociated Proteins
Hyaluronan BiosynthesisHAS3, KIAA1199
Glycosaminoglycan MetabolismSLC35B2, B3GAT2, BGNA
Carbohydrate MetabolismAGL, SLC5A9, HPSE

Data from pathway databases .

Disease Associations

  • Cancer: HAS1 splice variants linked to genetic instability and metastasis .

  • Rheumatoid Arthritis: Elevated HA levels in serum correlate with disease severity .

  • Obesity: Stromal HAS1 expression correlates with large tumor size .

Diagnostic Tools

  • Antibodies: Monoclonal antibodies (e.g., M04784) for Western blot and immunofluorescence .

  • ELISA: Measures HA secretion in cell culture supernatants .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipment of the format currently in stock. If you require a specific format, please specify this in your order notes.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested. Please contact us in advance for dry ice shipments, as additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HAS1; HAS; Hyaluronan synthase 1; Hyaluronate synthase 1; Hyaluronic acid synthase 1; HA synthase 1; HuHAS1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-578
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
HAS1
Target Protein Sequence
MRQQDAPKPTPAACRCSGLARRVLTIAFALLILGLMTWAYAAGVPLASDRYGLLAFGLYG AFLSAHLVAQSLFAYLEHRRVAAAARGPLDAATARSVALTISAYQEDPAYLRQCLASARA LLYPRARLRVLMVVDGNRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPAAAGAVGA GAYREVEAEDPGRLAVEALVRTRRCVCVAQRWGGKREVMYTAFKALGDSVDYVQVCDSDT RLDPMALLELVRVLDEDPRVGAVGGDVRILNPLDSWVSFLSSLRYWVAFNVERACQSYFH CVSCISGPLGLYRNNLLQQFLEAWYNQKFLGTHCTFGDDRHLTNRMLSMGYATKYTSRSR CYSETPSSFLRWLSQQTRWSKSYFREWLYNALWWHRHHAWMTYEAVVSGLFPFFVAATVL RLFYAGRPWALLWVLLCVQGVALAKAAFAAWLRGCLRMVLLSLYAPLYMCGLLPAKFLAL VTMNQSGWGTSGRRKLAANYVPLLPLALWALLLLGGLVRSVAHEARADWSGPSRAAEAYH LAAGAGAYVGYWVAMLTLYWVGVRRLCRRRTGGYRVQV
Uniprot No.

Target Background

Function

Recombinant Human Hyaluronan synthase 1 (HAS1) catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. This enzyme is crucial for hyaluronan synthesis, a key component of most extracellular matrices. Hyaluronan plays a structural role in tissue architecture and regulates cell adhesion, migration, and differentiation. HAS1 is one of the isozymes responsible for this reaction and can also catalyze chito-oligosaccharide synthesis depending on the substrate.

Gene References Into Functions
  1. Hyaluronic acid synthase-1 promotes malignant transformation via epithelial-to-mesenchymal transition, micronucleation, and centrosome abnormalities. PMID: 29137675
  2. A HAS1-miR214-SOX-4 pathway regulates the growth and metastasis of Esophageal squamous cell carcinoma (ESCC), offering a potential therapeutic target. PMID: 28656277
  3. Reduced HAS1 and HAS2 expression correlates with melanoma progression, suggesting prognostic significance. PMID: 27184066
  4. Minor allele genotypes of HAS1 SNPs are more prevalent in multiple myeloma (MM), Waldenström's macroglobulinemia (WM), chronic lymphocytic leukemia (CLL), and in affected family members with monoclonal gammopathy compared to breast cancer, monoclonal gammopathy of undetermined significance (MGUS), or healthy donors. PMID: 24950197
  5. Studies have analyzed the transcriptional regulation of the HAS1 and HAS2-antisense RNA 1 genes. PMID: 25325984
  6. HAS1 is the primary enzyme responsible for hyaluronan production by normal keratinocytes. PMID: 24658508
  7. The HAS1-dependent coat is induced by inflammatory agents and glycemic stress, mediated by altered presentation of CD44 or hyaluronan, providing a rapid cellular response to injury and inflammation. PMID: 24099991
  8. Genes involved in apoptosis, cell cycle regulation, adhesion, transcription, heat shock, and WNT pathways are affected by FAK or HAS3 inhibition. PMID: 22934709
  9. Inverse expression of hyaluronidase 2 and hyaluronan synthases 1-3 is associated with reduced hyaluronan content in malignant cutaneous melanoma. PMID: 23560496
  10. Aberrant intronic HAS1 splicing in multiple myeloma patients may be due to intronic HAS1 deletions and mutations frequent in MM patients but absent in healthy donors. PMID: 23301075
  11. TGF-beta1 up-regulation of HAS1 transcription is mediated via Smad3, not Smad2, while HAS1 induction by IL-1beta is Sp3, not Sp1, dependent. PMID: 23123404
  12. Hyaluronan synthase 1 (HAS1) requires a higher cellular UDP-GlcNAc concentration than HAS2 and HAS3. PMID: 23303191
  13. HA chains synthesized by HAS1 and HAS2 contribute to outflow resistance, while HAS3 does not appear to play a significant role. PMID: 22695958
  14. Analysis of cervical glycosaminoglycan composition during normal pregnancy and preterm birth shows HAS1 expression in preterm birth, while HAS2 is induced at term. PMID: 22529214
  15. This study provides strong evidence that HAS1-driven hyaluronan synthesis is a target of estradiol in human vascular smooth muscle cells. PMID: 21901291
  16. HYAL-1 and HAS1 expression predicted bladder cancer metastasis, and HYAL-1 expression also predicted disease-specific survival. PMID: 20960509
  17. Hyaluronan synthases (HAS1-3) and hyaluronidases (HYAL1-2) are involved in hyaluronan accumulation in endometrioid endometrial carcinoma. PMID: 20875124
  18. Significant changes in HA synthase (HAS) and hyaluronidase (HYAL) expression levels were observed in vitro upon stimulation of epithelial ovarian carcinoma cells by gonadotropins. PMID: 20072653
  19. Hyaluronan synthase expression in prostate adenocarcinoma cells. PMID: 11790779
  20. Characterization of expression and hyaluronan synthesis in bone marrow mesenchymal progenitor cells; predominant mRNA expression and up-regulated hyaluronan synthesis in bone marrow cells derived from multiple myeloma patients. PMID: 12239172
  21. HAS1 expression in Waldenström's macroglobulinemia. HAS1 variants synthesize the intracellular HA ligand for RHAMM and may contribute to genetic instability. PMID: 12720129
  22. Each hyaluronan synthase isoform's expression is regulated differently by growth factors and cytokines in vascular endothelial cells. Expressed in proliferative membranes from proliferative vitreoretinal diseases; may affect disease progression. PMID: 14636845
  23. Hyaluronan synthase 1 variants play a role in multiple myeloma progression. PMID: 15731173
  24. Increased HAS1 expression and serum hyaluronan in endometrial cancer may be associated with disease progression through myometrial invasion and lymph-vascular space involvement. PMID: 15870928
  25. IkappaB kinase and IkappaBalpha reveal NF-kappaB-dependent and NF-kappaB-independent pathways of HAS1 activation. PMID: 16258173
  26. HAS1 mRNA is undetectable, but HAS3 mRNA is readily detected in freshly isolated CD133+ and CD133- umbilical cord blood (UCB) cells. HAS2 mRNA is only detectable in CD133+ progenitor cells. PMID: 16564133
  27. In type-B synoviocytes (TBS), HAS1 is a gene dependent on the transcription factor nuclear factor kappa B (NF-kappaB) for activation. PMID: 16723203
  28. This study evaluated how TNF-alpha, IFN-gamma, IL-1beta, and oxidative stress modulate HAS activities in normal human skin fibroblasts. PMID: 16786194
  29. Interleukin-1beta stimulation induced HAS1 and HAS2 transcription but did not induce phenotypic differentiation or hyaluronan coat assembly. PMID: 17611197
  30. HAS1 captured in a pull-down approach is readily immunodetected by Western blot analysis. PMID: 17904513
  31. Growth factor treatment up-regulated HAS gene expression and increased HAS enzymes and HA production in fibroblasts. PMID: 17922656
  32. HAS1 regulates bladder cancer growth and progression by modulating hyaluronic acid synthesis and receptor levels. PMID: 18199543
  33. HAS1 is activated by Epstein-Barr virus and synthetic double- and single-stranded viral RNA analogs. PMID: 18400745
  34. Genetic contributions to aberrant HAS1 gene splicing in multiple myeloma and Waldenström's macroglobulinemia were characterized; 3616 bp in HAS1 exons and introns involved in aberrant splicing from 17 patients were sequenced. PMID: 18815290
  35. HAS expression in human articular chondrocytes during de- and re-differentiation processes. PMID: 19148550
  36. Intensive sequencing of the HAS1 gene in malignant and normal cells from WM patients identified mutations in HAS1 exons and introns. PMID: 19362966
  37. HAS1, HAS2, and HAS3 expression is not consistently elevated in ovarian carcinomas. PMID: 19435493
  38. HAS1 splice variants multimerize with and modulate normally spliced HAS1 protein. PMID: 19451652
  39. siHAS2 and siHAS1 transfection showed that mainly HAS1 synthesized high molecular weight HA regulates HT1080 cell motility. PMID: 19577615
  40. HAS activity can be modulated by post-translational modifications, such as phosphorylation and N-glycosylation. PMID: 19737932
Database Links

HGNC: 4818

OMIM: 601463

KEGG: hsa:3036

STRING: 9606.ENSP00000222115

UniGene: Hs.57697

Protein Families
NodC/HAS family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed. Highly expressed in ovary followed by spleen, thymus, prostate, testes and large intestine. Weakly expressed in small intestine.

Q&A

What is Hyaluronan Synthase 1 and how does it differ from other HAS isoenzymes?

Hyaluronan synthase 1 (HAS1) is one of three isoenzymes responsible for cellular hyaluronan synthesis in mammalian cells . Unlike its counterparts HAS2 and HAS3, HAS1 demonstrates lower enzymatic activity and requires higher concentrations of sugar precursors for hyaluronan synthesis, even when overexpressed in cell cultures . The enzyme exhibits distinct substrate affinities, with its Km (Michaelis constant) for UDP-GlcUA approximately double that of HAS2-3, and its Km toward UDP-GlcNAc about two to three times higher than the other HAS enzymes .

These biochemical differences translate to functional distinctions in cellular contexts. Most notably, HAS1 produces a unique "cloudy" pericellular hyaluronan coat structure that differs markedly from the tight, concentrated coats around plasma membrane protrusions produced by HAS2 and HAS3 . Additionally, while high overexpression of HAS1 in cell types with little endogenous hyaluronan production is insufficient to produce a clearly visible hyaluronan coat, inflammatory agents or glucosamine can induce significant coat development .

How is HAS1 expression regulated at the transcriptional level?

HAS1 expression is regulated by diverse transcriptional mechanisms, predominantly in response to inflammatory mediators and stress conditions. Pro-inflammatory cytokines like interleukin-1β (IL-1β) induce HAS1 expression in fibroblasts through nuclear factor kappa B (NF-κB) and tyrosine kinase pathways . Similarly, transforming growth factor-β (TGF-β) upregulates HAS1 in synoviocytes via the p38 MAPK signaling pathway .

Transcription factors sp1 and sp3 have been implicated as mediators for some of these regulatory effects . Beyond cytokine regulation, environmental stressors like ultraviolet B radiation can rapidly upregulate Has1 expression in rat epidermal keratinocytes . Metabolic conditions including renal and pulmonary ischemia, as well as hyperglycemia, also elevate Has1 expression levels . Notably, while HAS genes are often regulated in parallel, their responses to specific stimuli may be similar or opposite depending on cell type .

What role does HAS1 play in inflammation?

HAS1 appears to serve a pivotal function during cellular stress responses, particularly inflammation. Its expression is upregulated by inflammatory mediators including TGF-β, IL-1β, TNF-α, and prostaglandins . This induction pattern explains why Has1/HAS1 upregulation has been documented in numerous inflammation-associated conditions, including murine atherosclerosis, human osteoarthritis, murine infectious lung disease, and human rheumatoid arthritis .

The inflammatory role of HAS1 may be attributed to its production of a specific type of pericellular hyaluronan coat with pro-inflammatory properties. Under inflammatory conditions or glycemic stress, HAS1 produces an expanded pericellular hyaluronan coat that differs structurally from those produced by other HAS enzymes . Unlike the tight coats formed around microvillus protrusions by HAS3, the HAS1-produced coat is looser but more extensive, and critically dependent on CD44 interactions . This distinctive hyaluronan coat has been associated with monocyte binding in several cell types, and hyaluronan produced specifically by HAS1 binds mononuclear cells more effectively than hyaluronan synthesized by the other HAS enzymes .

How do substrate availability and affinity influence HAS1 enzymatic activity?

HAS1 exhibits unique substrate dependencies that significantly impact its enzymatic function. The enzyme demonstrates lower affinity for both UDP-GlcUA and UDP-GlcNAc compared to HAS2 and HAS3, with Km values approximately two to three times higher than its counterparts . All HAS enzymes show lower affinity toward UDP-GlcNAc than for UDP-GlcUA .

This differential substrate affinity is particularly evident in overexpression studies using cell lines with negligible endogenous hyaluronan production, such as COS-1 and MCF-7. In these models, HAS1 overexpression alone produces minimal hyaluronan, but supplementation with glucose or glucosamine—compounds that increase hyaluronan substrate availability—enables significant hyaluronan production in a dose-dependent manner . This suggests that while HAS1 may play a minor role in baseline hyaluronan synthesis, it becomes substantially more active when substrate concentrations increase .

The practical implication is that HAS1's lower substrate affinity makes it more responsive to fluctuations in UDP-GlcNAc and UDP-GlcUA levels compared to other HAS enzymes. Treatments with compounds like mannose and glucosamine that modulate UDP-GlcNAc content correspondingly affect cellular hyaluronan secretion levels . These substrate dynamics may explain why HAS1 is particularly responsive to metabolic changes that occur during inflammation and stress conditions.

What are the structural and functional characteristics of the HAS1-produced hyaluronan coat?

The hyaluronan coat produced by HAS1 displays distinctive structural and functional properties that differentiate it from coats synthesized by HAS2 and HAS3. Visually, the HAS1-produced coat has a more diffuse, "cloudy" appearance, in contrast to the tight, concentrated coats that form around plasma membrane protrusions with HAS2 and especially HAS3 .

A defining feature of the HAS1-produced hyaluronan coat is its strong dependence on interactions with CD44, a major hyaluronan receptor . This dependency suggests a mechanistic basis for HAS1's specialized functions. Furthermore, the HAS1 hyaluronan coat demonstrates remarkable inducibility—while even high HAS1 overexpression produces minimal visible coat in cells with low endogenous hyaluronan production, treatment with inflammatory mediators or glucosamine stimulates substantial coat development .

Functionally, the HAS1-produced hyaluronan coat appears optimized for immune cell interactions. Hyaluronan synthesized specifically by HAS1 binds mononuclear cells more effectively than hyaluronan produced by other HAS enzymes . This enhanced binding capacity provides a potential mechanism for HAS1's involvement in inflammatory processes. The expanded, CD44-dependent coat produced under inflammatory conditions may create a specialized microenvironment that facilitates immune cell recruitment and retention.

How do alternative splicing and genetic variations of HAS1 contribute to disease pathology?

Alternative splicing and genetic variations of HAS1 play significant roles in disease progression, particularly in cancer and inflammatory conditions. Splice variants of HAS1 have been implicated in genetic instability, potentially contributing to oncogenic transformation . This susceptibility to genetic alterations may explain why HAS1 was the most upregulated gene in aneuploid mouse embryonic fibroblasts exhibiting malignant properties .

These findings suggest that both altered HAS1 expression and structural variations of the enzyme contribute to pathological processes. The mechanisms may involve disrupted hyaluronan synthesis, altered inflammatory responses, or changes in the tumor microenvironment. Understanding the specific contributions of HAS1 variants to disease progression represents an important frontier in hyaluronan research.

What are the optimal conditions for expressing and assaying recombinant HAS1 activity?

Successful expression and activity assessment of recombinant HAS1 requires careful optimization of experimental conditions, particularly regarding substrate availability. When expressing recombinant HAS1 in cell lines with minimal endogenous hyaluronan production (such as COS-1 or MCF-7), supplementation with glucose or glucosamine is essential to enable significant hyaluronan synthesis . This supplementation increases the availability of the UDP-sugar substrates required by HAS1, compensating for its lower substrate affinity compared to other HAS enzymes .

For activity assays, buffer composition significantly impacts HAS1 function. A typical assay buffer for hyaluronidase activity (which can be modified for HAS1 studies) contains 0.1 M NaOAc at pH 4.5 . For substrate labeling, buffers containing 25 mM MES, 0.5% Triton X-100, various divalent cations (2.5 mM MgCl₂, 2.5 mM MnCl₂, 1.25 mM CaCl₂), and carrier protein (0.75 mg/mL BSA) at pH 7.0 have been employed .

When designing experiments to assess HAS1 activity, it's critical to account for its unique substrate requirements. The Km of HAS1 for UDP-GlcUA is approximately double that of HAS2-3, while its Km for UDP-GlcNAc is two to three times higher . Therefore, substrate concentrations should be adjusted accordingly to achieve reliable activity measurements. Detection methods commonly employ electrophoretic separation of reaction products on 8% SDS-PAGE gels, followed by appropriate visualization techniques such as autoradiography for radiolabeled substrates .

How can researchers visualize and quantify the HAS1-produced hyaluronan coat?

Visualization and quantification of the HAS1-produced hyaluronan coat require specialized techniques that account for its unique structural properties. Confocal microscopy represents the gold standard for visualizing the pericellular hyaluronan coat, particularly when combined with fluorescent labeling of both HAS1 and hyaluronan . This approach has revealed the distinctive "cloudy" appearance of the HAS1-produced coat, in contrast to the tighter structures formed by HAS2 and HAS3 .

For optimal visualization, experimental designs often incorporate fluorescent fusion proteins (such as Dendra2-HAS1) to track enzyme localization alongside specific staining for hyaluronan . Nuclear counterstaining provides spatial reference points. This multi-channel imaging approach enables assessment of both the enzyme distribution and the resulting hyaluronan coat structure.

When studying HAS1-specific coat formation, researchers should consider including conditions that enhance coat development. Treatment with 1 mM glucosamine for 6 hours has been shown to significantly induce the growth of the hyaluronan coat produced by HAS1 . Similarly, various pro-inflammatory factors can stimulate coat formation. Quantification can be achieved through image analysis of coat dimensions, fluorescence intensity measurements, or biochemical analysis of released hyaluronan using techniques such as ELISA or high-performance liquid chromatography.

What approaches can be used to study the interaction between HAS1-produced hyaluronan and CD44?

The CD44-dependent nature of the HAS1-produced hyaluronan coat necessitates specialized methods to study this critical interaction. Several complementary approaches can provide insights into this relationship:

Genetic manipulation strategies offer direct evidence of CD44 dependency. Experiments comparing hyaluronan coat formation in wild-type cells versus CD44-knockout or CD44-depleted (via siRNA) models can demonstrate the requirement for CD44 in maintaining the HAS1-produced coat . Similarly, CD44 overexpression studies can assess whether enhanced receptor availability affects coat characteristics.

Co-immunoprecipitation techniques can identify physical associations between HAS1, hyaluronan, and CD44, potentially revealing molecular complexes that mediate coat formation. For visualization of these interactions, proximity ligation assays or fluorescence resonance energy transfer (FRET) microscopy can detect close associations between fluorescently labeled HAS1 and CD44 in intact cells.

Functional studies examining monocyte binding to the hyaluronan coat provide valuable insights into the biological significance of the HAS1-CD44 interaction . Comparison of binding efficiency between hyaluronan produced by different HAS enzymes can highlight the specialized properties of HAS1-synthesized hyaluronan. Blocking antibodies against CD44 or competitive inhibition with soluble hyaluronan can confirm the specificity of these interactions.

How does HAS1 expression correlate with inflammatory disease progression?

In respiratory conditions, Has1 expression increases during murine infectious lung disease . Interestingly, in murine asthma models, Has1 mRNA follows a biphasic pattern—increasing at early stages but decreasing later in disease progression . This temporal variation highlights the dynamic nature of HAS1's role in inflammation.

Oral inflammatory conditions also show HAS1 involvement. In oral lichen planus, a chronic inflammatory disease of the oral mucosa, elevated HAS1 expression is observed, particularly in the basal layers of the epithelium—the most inflamed area in this condition . This localization pattern suggests that HAS1 upregulation occurs specifically in regions of active inflammation.

The mechanistic basis for these correlations likely involves HAS1's responsiveness to inflammatory mediators and its production of a pro-inflammatory hyaluronan coat. The HAS1-synthesized hyaluronan preferentially binds mononuclear cells, potentially facilitating immune cell recruitment to inflamed tissues . These findings collectively suggest that HAS1 could serve as both a biomarker and therapeutic target in inflammatory conditions.

What is the potential of targeting HAS1 in cancer therapy?

Several mechanisms may underlie HAS1's role in cancer progression. Splice variants of HAS1 can contribute to genetic instability, potentially driving oncogenic transformation . Additionally, Has1 was identified as the most upregulated gene in aneuploid mouse embryonic fibroblasts with malignant properties . At the tumor-host interface, stromal expression of HAS1 correlates with obesity and larger tumor size in breast cancer patients , suggesting a role in shaping the tumor microenvironment.

Therapeutic approaches targeting HAS1 could include small molecule inhibitors of enzymatic activity, antibodies disrupting HAS1-dependent signaling, or strategies to normalize aberrant HAS1 splicing. The differential expression of HAS1 in malignant versus normal tissues provides a potential window for therapeutic selectivity. Additionally, combination therapies targeting both HAS1 and inflammatory pathways might offer synergistic benefits, given HAS1's strong association with inflammatory processes.

How can understanding HAS1 substrate requirements inform metabolic interventions in inflammatory conditions?

HAS1's unique substrate requirements and sensitivity to metabolic conditions offer intriguing possibilities for metabolic interventions in inflammatory diseases. The enzyme's lower affinity for UDP-GlcUA and UDP-GlcNAc compared to other HAS enzymes makes it particularly responsive to fluctuations in substrate availability . This property could be exploited therapeutically through targeted manipulation of cellular metabolism.

In experimental models, treatments with glucose or glucosamine significantly enhance HAS1 activity by increasing the availability of UDP-sugar substrates . Visually, glucosamine treatment (1 mM for 6 hours) induces substantial growth of the HAS1-produced hyaluronan coat . This metabolic responsiveness suggests that dietary or pharmacological interventions affecting sugar metabolism could modulate HAS1 activity in inflammatory conditions.

The mechanistic connection between metabolism and inflammation through HAS1 is further supported by observations that Has1 expression increases during hyperglycemia and that obesity correlates with stromal HAS1 levels in breast tumors . These findings align with the growing recognition of metabolic dysfunction as a driver of chronic inflammation.

Potential metabolic interventions could include selective inhibition of UDP-sugar synthesis pathways, dietary modifications affecting substrate availability, or targeted delivery of substrate analogs that compete with natural UDP-sugars. Since HAS1's activity becomes more prominent under inflammatory conditions, such interventions might preferentially affect pathological rather than physiological hyaluronan production.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.