Recombinant Human Hyaluronan synthase 2 (HAS2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format requirements, please specify them in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery time information.
Note: All protein shipments are accompanied by standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
HAS2; Hyaluronan synthase 2; Hyaluronate synthase 2; Hyaluronic acid synthase 2; HA synthase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-552
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
HAS2
Target Protein Sequence
MHCERFLCILRIIGTTLFGVSLLLGITAAYIVGYQFIQTDNYYFSFGLYGAFLASHLIIQ SLFAFLEHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVI DGNSEDDLYMMDIFSEVMGRDKSATYIWKNNFHEKGPGETDESHKESSQHVTQLVLSNKS ICIMQKWGGKREVMYTAFRALGRSVDYVQVCDSDTMLDPASSVEMVKVLEEDPMVGGVGG DVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCISGPLGMYRNSLLHEFVEDWY NQEFMGNQCSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQQTRWSKSYFR EWLYNAMWFHKHHLWMTYEAIITGFFPFFLIATVIQLFYRGKIWNILLFLLTVQLVGLIK SSFASCLRGNIVMVFMSLYSVLYMSSLLPAKMFAIATINKAGWGTSGRKTIVVNFIGLIP VSVWFTILLGGVIFTIYKESKRPFSESKQTVLIVGTLLYACYWVMLLTLYVVLINKCGRR KKGQQYDMVLDV
Uniprot No.

Target Background

Function
Hyaluronan synthase 2 (HAS2) catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. This enzyme is essential for hyaluronan synthesis, a major component of most extracellular matrices. Hyaluronan plays a crucial structural role in tissue architectures and regulates cell adhesion, migration, and differentiation. HAS2 is one of the isozymes responsible for this reaction, specifically catalyzing the synthesis of high molecular mass hyaluronan. It is critical for the transition of endocardial cushion cells into mesenchymal cells, a process vital for heart development. HAS2 may also contribute to vasculogenesis. High molecular mass hyaluronan is also involved in early contact inhibition, a process that halts cell growth when cells come into contact with each other or the extracellular matrix.
Gene References Into Functions
  1. Hyaluron synthase 2 plays a role in stem cell senescence PMID: 27339908
  2. COX-2, GREM1, and HAS2 are cumulus cell genes that potentially determine oocyte and embryo developmental competence. (Review) PMID: 29537212
  3. HAS2 might be a crucial regulator of the fate of pulmonary fibrosis. A proposed model suggests that HAS2 overexpression promotes an invasive phenotype resulting in severe fibrosis, while downregulation of HAS2 promotes resolution. PMID: 26987798
  4. Research indicates that cancer-associated fibroblasts (CAFs) express higher levels of HAS2. This suggests that HAS2 is a key regulator in CAF-mediated oral squamous cell carcinoma progression by modulating the balance of MMP1 and TIMP1. PMID: 27884164
  5. Findings demonstrate that hypoxia induces HAS2 expression and subsequent HA production, contributing to epithelial-mesenchymal transition (EMT) of oral squamous cell carcinoma. This process is mediated by HAS2-AS1, which can bind to the HAS2 gene, inducing its transcription. PMID: 28485478
  6. HAS2, tumor cell-derived hyaluronic acid (HA), and ZEB1 form a positive feedback loop. ZEB1, elevated by HA, directly activates HAS2 expression in breast cancer. PMID: 28086235
  7. Data reveals a selective up-regulation of HAS2 expression by extracellular Uridine Triphosphate, likely contributing to the previously observed rapid activation of hyaluronan metabolism in response to tissue trauma or ultraviolet radiation. PMID: 28188289
  8. HAS2 and HAS3 were the only hyaluronan synthases detected, with similar expression levels in NPs and NM. PMID: 26661071
  9. HAS2 has been proposed as a target for therapeutic intervention in cancer. Findings suggest a potential antagonistic role of the androgen receptor (AR) pathway on HAS2 function. PMID: 27169756
  10. HAS-2 gene silencing may inhibit proliferation and promote apoptosis in the MCF-7 human breast cancer cell line. PMID: 27915342
  11. Research establishes HAS2-mediated HA synthesis as a driver of growth in bladder cancer with low AGL and provides preclinical rationale for personalized targeting of HAS2/HA signaling in patients with low amylo-alpha-1-6-glucosidase-4-alpha-glucanotransferase -expressing tumors. PMID: 26490312
  12. The HAS2-HA system influences the biological characteristics of human breast cancer cells. PMID: 26722395
  13. Studies have identified HAS2 as a novel candidate gene for susceptibility to adult asthma. PMID: 25251750
  14. In contrast to other carcinoma subtypes, HAS2 expression was observed in up to 72.7% of metaplastic carcinomas of breast, a carcinoma subtype related to the epithelial-mesenchymal transition. PMID: 24527698
  15. Review of the roles of HAS2 and CD44 in breast tumorigenesis [review] PMID: 25081531
  16. mir-23a-3p causes cellular senescence by targeting hyaluronan synthase 2: possible implication for skin aging. PMID: 25264594
  17. HAS2 may be involved in the etiology of non-syndromic VSD and have a vital function in the development of the heart septum. PMID: 24558368
  18. Stimulation with LPS caused rapid increases in versican mRNA and protein, a rapid increase in Has1 mRNA, and concomitant inhibition of hyaluronidases 1 and 2, the major hyaluronan degrading enzymes. PMID: 24472738
  19. UDP-glucose activates P2Y14 receptor and JAK2, increases STAT3 Tyr705 phosphorylation, and enhances transcription of HAS2. PMID: 24847057
  20. Melanoma cell-derived factors stimulate hyaluronan synthesis in dermal fibroblasts by upregulating HAS2 through PDGFR-PI3K-AKT and p38 signaling. PMID: 22825838
  21. Findings suggest that rs2046571 of the HSA2 has a marginal association with PD in the Chinese population. PMID: 23916661
  22. HAS2 knockdown sensitizes cancer cells to radiation via persistent DNA damage. PMID: 24333416
  23. Inhibition of miR-21 has no effect on thrombospondin (TSP)-1-stimulated expression of HAS2. PMID: 24314882
  24. Data suggests that expression of HAS2 is lower in trophoblasts from the first-trimester placenta of miscarriage than in normal subjects. The products of HAS2 (high/medium MW hyaluronan) promote cell proliferation/invasion and inhibit apoptosis. PMID: 23806178
  25. Data indicates that oxLDL doubled the transcripts of hyaluronan synthases HAS2 and HAS3 and hyaluronan deposition via the scavenger receptor LOX-1. PMID: 23979132
  26. Experiments suggest that downregulation of HAS2 may be responsible for inhibition of hyaluronate synthesis in the self-assembled 2-nM T3 human dermal matrix. PMID: 23397370
  27. HAS 2 may be a potential therapeutic target for the treatment of oral cavity cancer. PMID: 22473523
  28. COL6A1 and COL6A2 silencing downregulates HAS2 expression in Down syndrome fibroblasts. PMID: 23452080
  29. No significant difference (P > 0.05) was found between the level of HAS2 synthesized by control cells and NCTC 2544 cells treated with Plantaricin A preparations. PMID: 22742591
  30. Polymorphisms in HAS2 are potentially involved in glaucomatous neurodegeneration. PMID: 22960332
  31. Role of UDP-N-acetylglucosamine (GlcNAc) and O-GlcNAcylation of hyaluronan synthase 2 in the control of chondroitin sulfate and hyaluronan synthesis. PMID: 22887999
  32. A previously unknown downstream target of beta-catenin, HAS2, was identified in prostate cancer. PMID: 22298898
  33. Findings highlight a critical role of HAS2 in the development of a prometastatic microenvironment. PMID: 22113945
  34. The difference in control of HAS2 expression allows the activation of one of the mechanisms underlying Graves ophthalmopathy, adipogenesis, to be biologically linked with the second, Hyaluronan overproduction. PMID: 22162480
  35. Hyaluronan synthase 2 (HAS2) promotes breast cancer cell invasion by suppression of tissue metalloproteinase inhibitor 1 (TIMP-1). PMID: 22016393
  36. The HAS2-HYAL2/CD44 system may support spontaneous chemokinesis of human cancer cells through self-degradation of HMW-HA to produce LMW-HA by an autocrine mechanism. PMID: 21743962
  37. Pulsatile, arterial-like shear stress conditions induced enzyme and hyaluronan effectively, while lower shear stress that continuously changed its direction did not induce any differences compared to control cultures not exposed to shear stress. PMID: 21551265
  38. Altered binding of SP1 and YY1 to the promoter correlated with cellular UDP-N-acetylhexosamines content and inhibition of HAS2 expression. PMID: 21795679
  39. Transcriptional induction of HAS2-AS1 and HAS2 occurs simultaneously in PTCs. This suggests that transcription of the antisense RNA stabilizes or augments HAS2 mRNA expression in these cells via RNA/mRNA heteroduplex formation. PMID: 21357421
  40. The combined HAS2-HYAL-1 biomarker detected bladder cancer and significantly predicted its recurrence. PMID: 20960509
  41. Hyaluronan synthesis is inhibited by adenosine monophosphate-activated protein kinase through the regulation of HAS2 activity in human aortic smooth muscle cells. PMID: 21228273
  42. Interleukin 1beta and tumor necrosis factors alpha and beta, but not transforming growth factors alpha and beta, strongly induced HA synthesis by the NF-kappaB pathway, activating hyaluronan synthase 2. PMID: 20522558
  43. Upregulation of HAS2 expression via EP(2) and IP receptors might contribute to the accumulation of HA during human atherosclerosis, thereby mediating proatherosclerotic functions of COX2. PMID: 14752026
  44. The base sequence of this gene's promoter is sequenced. PMID: 14988410
  45. Fusion with PLAG1 protein in lipoblastoma. PMID: 15642402
  46. IL-1beta induction of HAS2 expression involves multiple signaling pathways that act in concert, leading to an increase in hyaluronan expression by jejunum-derived mesenchymal cells. PMID: 15677552
  47. The Has2 gene is a potent primary EGF and all-trans-RA responding gene with complex regulation. PMID: 15722343
  48. Natural antisense mRNAs of HAS2 may have a significant and novel regulatory role in the control of HAS2, hyaluronan biosynthesis, and HA-dependent cell functions. PMID: 15843373
  49. Antisense inhibition of HAS2 in osteosarcoma cells inhibits hyaluronan retention and tumorigenicity. PMID: 15922739
  50. Sp1 and Sp3 are principal mediators of HAS2 constitutive transcription. PMID: 16603733

Show More

Hide All

Database Links

HGNC: 4819

OMIM: 601636

KEGG: hsa:3037

STRING: 9606.ENSP00000306991

UniGene: Hs.159226

Involvement In Disease
A chromosomal aberration involving HAS2 may be a cause of lipoblastomas, which are benign tumors resulting from transformation of adipocytes, usually diagnosed in children. 8q12.1 to 8q24.1 intrachromosomal rearrangement with PLAG1.
Protein Families
NodC/HAS family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in fibroblasts.

Q&A

What is Hyaluronan Synthase 2 and what is its functional significance?

Hyaluronan synthase 2 (HAS2) is a bifunctional glycosyltransferase that catalyzes the addition of GlcNAc (N-acetylglucosamine) and GlcUA (glucuronic acid) monosaccharides to the nascent hyaluronan polymer . This enzyme is essential for the synthesis of hyaluronan, a major component of most extracellular matrices that serves crucial structural roles in tissue architecture . HAS2 regulates multiple cellular processes including cell adhesion, migration, and differentiation by producing hyaluronan as a fundamental extracellular matrix component . Notably, HAS2 is one of three isoenzymes (along with HAS1 and HAS3) responsible for cellular hyaluronan synthesis, but it is particularly responsible for the synthesis of high molecular mass hyaluronan . Researchers should understand that HAS2 belongs to the NodC/HAS family of enzymes, representing the Class I membrane-integrated hyaluronan synthases with distinct architectural and functional characteristics .

How is HAS2 structurally characterized and classified?

HAS2 belongs to the Class I hyaluronan synthases, which are membrane-integrated enzymes that employ a processive chain elongation mechanism and secrete hyaluronan across the plasma membrane . The enzyme contains a single GT family-2 (GT-2) module that adds both monosaccharide units (GlcNAc and GlcUA) to the nascent chain . Class I enzymes are further subdivided based on the directionality of polymer extension; HAS2 can be classified as a Class I-R or I-NR enzyme, depending on whether it elongates the hyaluronan polysaccharide at the reducing or non-reducing end, respectively . The complex operation of HAS2 is accomplished by functionally integrating a cytosolic catalytic domain with a channel-forming transmembrane region . When working with recombinant forms, researchers commonly use fragments of the protein, such as the 102-200 amino acid range, which contains important catalytic regions .

What post-translational modifications regulate HAS2 activity?

Phosphorylation represents a critical post-translational modification that regulates HAS2 activity and localization. Specifically, phosphorylation at threonine-328 (Thr-328) is essential for hyaluronan synthase activity . Additionally, phosphorylation at threonine-110 (Thr-110) is required for transport of the enzyme from the endoplasmic reticulum (ER) to the Golgi apparatus . When designing experiments to study HAS2 function, researchers should consider these phosphorylation sites as potential targets for mutagenesis studies or as markers for monitoring the activation state of the enzyme. Phospho-specific antibodies can be employed to detect these modifications in experimental settings, providing insights into the regulation of HAS2 trafficking and enzymatic activity.

How do the different HAS isoforms compare in expression patterns and function?

The three hyaluronan synthase isoforms (HAS1, HAS2, and HAS3) exhibit distinct expression patterns and functional characteristics in various physiological and pathological conditions. In kidney injury models, Has2 mRNA expression shows markedly increased levels compared to Has1, with a 9-10-fold induction following ischemia-reperfusion injury (IRI) . This suggests that HAS2 is more likely to be disease-promoting in kidney tissues than HAS1 . Has3 mRNA expression remains relatively unchanged in these conditions . Immunofluorescence detection reveals that HAS2 protein is not typically identified in the renal cortex of normal kidneys but shows noticeable increases in interstitial expression following injury . When designing experiments to study specific HAS isoforms, researchers should carefully select tissue models that express the isoform of interest and consider the differential responses of these isoforms to pathological stimuli.

What expression systems are optimal for producing active recombinant HAS2?

Several expression systems have been successfully employed for producing active recombinant HAS2, each with distinct advantages and limitations:

Expression SystemAdvantagesLimitationsNotable Features
Escherichia coliHigh yield, economical, scalablePotential issues with protein folding and post-translational modificationsFirst successful expression of active HAS2 catalytic domain
Wheat germEukaryotic system, suitable for ELISA and Western blot applicationsLower yield than bacterial systemsProduces human HAS2 fragment (102-200 aa range)
Adenoviral vectorsAllows enforced expression in mammalian cells, maintains native modificationsMore complex methodology, requires viral vector constructionUseful for in vitro and in vivo studies of HAS function

How can researchers accurately measure the enzymatic activity of recombinant HAS2?

Measuring the enzymatic activity of recombinant HAS2 requires specialized techniques that can detect the formation of hyaluronan polymers. Common methodological approaches include:

  • Oligomer synthesis detection: Monitoring the formation of hyaluronan oligomers (e.g., from 8-mer to 16-mer) using techniques such as gel electrophoresis or high-performance liquid chromatography (HPLC) .

  • UDP-sugar incorporation assays: Measuring the incorporation of radioactively labeled UDP-sugars (UDP-GlcUA and UDP-GlcNAc) into polymerized hyaluronan.

  • Exogenous substrate utilization: Assessing the ability of engineered HAS2 to elongate sugars from exogenous tetrasaccharides to form longer polymers, which can provide insights into the directionality and processivity of the enzyme .

  • Hyaluronan quantification: Using specific binding proteins or antibodies to quantify the amount of hyaluronan produced in enzymatic reactions.

When conducting these assays, researchers should include appropriate controls to account for background activity and ensure the specificity of the measurements for HAS2-dependent hyaluronan synthesis.

What strategies can be employed to study the directionality of sugar elongation by HAS2?

The directionality of sugar elongation by HAS2 (whether at the reducing or non-reducing end) is a fundamental aspect of its mechanism. Research strategies to investigate this include:

  • Labeled substrate incorporation: Using differentially labeled UDP-sugars to track the incorporation of new monosaccharides into growing hyaluronan chains.

  • Analysis of engineered HAS2 variants: Studies with engineered HAS2 have demonstrated that it can elongate sugars from exogenous tetrasaccharides to form polymers with a direction toward the non-reducing end . Comparing wild-type and engineered variants can provide insights into directionality determinants.

  • Structural analysis: Comparing HAS2 with other glycosyltransferases of known directionality to identify structural features that determine the direction of chain elongation.

  • Kinetic analysis with defined oligosaccharide acceptors: Measuring the kinetics of elongation using oligosaccharides with defined reducing and non-reducing ends can provide direct evidence for the preferred direction of chain growth.

It's important to note that there are two alternative mechanisms for sugar elongation by hyaluronan synthases: some bacterial HASs add new sugars to the non-reducing end of the acceptor, while some vertebrate enzymes transfer sugars to the reducing end . Understanding these differences is critical for characterizing the enzymatic mechanism of human HAS2.

How do different experimental conditions affect HAS2 activity and product characteristics?

The activity of HAS2 and the characteristics of the hyaluronan products it synthesizes can be significantly influenced by experimental conditions. Researchers should consider:

  • pH and ionic strength: Optimal enzymatic activity typically occurs within narrow pH and salt concentration ranges.

  • UDP-sugar concentrations: The relative concentrations of UDP-GlcUA and UDP-GlcNAc can influence the rate of polymerization and potentially the length of the hyaluronan chains produced.

  • Presence of divalent cations: Many glycosyltransferases require specific divalent cations (often Mg²⁺ or Mn²⁺) for optimal activity.

  • Membrane environment: For full-length HAS2, the membrane environment can significantly impact activity, as the enzyme normally functions as an integral membrane protein with a transmembrane domain that forms a channel for hyaluronan secretion .

  • Protein phosphorylation state: As phosphorylation at specific residues (e.g., Thr-328) is essential for enzymatic activity, conditions that favor phosphorylation may enhance activity .

Systematic variation of these parameters can provide valuable insights into the factors controlling HAS2 activity and the structural characteristics of the hyaluronan it produces.

What are the critical factors for successful expression of active HAS2 in bacterial systems?

The successful expression of active HAS2 in bacterial systems, particularly E. coli, represents a significant achievement that enables large-scale production of this enzyme for various applications . Critical factors for optimizing bacterial expression include:

  • Domain selection: Focusing on expression of the catalytic region rather than the full-length protein has proven successful, as demonstrated by the production of recombinant human HAS2 proteins composed of only the catalytic region in E. coli as an active form .

  • Expression vector design: The choice of promoter, fusion tags, and other vector elements can significantly impact expression levels and protein solubility.

  • Induction conditions: Optimizing temperature, inducer concentration, and induction time can improve the yield of active protein.

  • Host strain selection: Different E. coli strains offer varying advantages for recombinant protein expression, including enhanced disulfide bond formation or improved rare codon usage.

The achievement of expressing active HAS2 in E. coli provides practical and economic advantages for manufacturing enzymes used in the synthesis of various oligomeric hyaluronan molecules and their industrial applications .

How can siRNA knockdown approaches be used to study HAS2 function in cellular systems?

RNA interference using small interfering RNA (siRNA) provides a valuable approach for studying HAS2 function through specific knockdown of gene expression in cellular systems. Methodological considerations include:

  • siRNA design and selection: Annealed oligonucleotide siRNA reagents specifically targeting HAS2 (e.g., assay ID s6458) should be carefully designed to ensure specificity and efficiency .

  • Transfection optimization: Different cell types may require specific transfection reagents and conditions for optimal siRNA delivery.

  • Validation of knockdown efficiency: Quantitative PCR and Western blot analyses should be performed to confirm the reduction in HAS2 mRNA and protein levels, respectively.

  • Functional assays: Following successful knockdown, researchers can assess the impact on hyaluronan production, cell migration, proliferation, and other relevant phenotypes.

  • Controls: Appropriate controls, including scrambled negative control transfections (e.g., ID 4611), are essential for distinguishing specific HAS2 knockdown effects from non-specific responses to siRNA treatment .

These approaches can provide valuable insights into the cellular functions of HAS2 and its role in various physiological and pathological processes.

What approaches can be used to study HAS2 phosphorylation and its impact on enzyme function?

Studying the phosphorylation of HAS2 and its functional consequences requires specialized techniques:

  • Site-directed mutagenesis: Creating phospho-mimetic (e.g., Thr to Asp or Glu) or phospho-deficient (e.g., Thr to Ala) mutations at key phosphorylation sites such as Thr-328 and Thr-110 can help elucidate the role of these modifications .

  • Phospho-specific antibodies: Developing and using antibodies that specifically recognize phosphorylated forms of HAS2 enables detection and quantification of phosphorylation levels under various conditions.

  • Mass spectrometry: Phosphopeptide mapping by mass spectrometry can identify the specific residues that are phosphorylated in vivo or in vitro.

  • Kinase inhibition studies: Using specific inhibitors of protein kinases that might target HAS2 can help identify the signaling pathways regulating HAS2 phosphorylation.

  • Subcellular localization studies: As phosphorylation at Thr-110 is required for transport from ER to Golgi, tracking the subcellular localization of wild-type versus phospho-deficient mutants can provide insights into the role of phosphorylation in HAS2 trafficking .

Understanding the phosphorylation state of HAS2 is particularly important as phosphorylation at Thr-328 is essential for hyaluronan synthase activity, while phosphorylation at Thr-110 regulates intracellular trafficking .

How do the three HAS isoforms differ in their expression patterns and roles in disease?

The three hyaluronan synthase isoforms (HAS1, HAS2, and HAS3) exhibit distinct expression patterns and roles in various physiological and pathological conditions:

HAS IsoformRelative Expression in Normal KidneyResponse to Kidney InjuryPotential Role in Disease
HAS1Low basal expressionModerate increase following injuryLess likely to be disease-promoting in kidneys
HAS2Not typically detected in renal cortexMarked increase (9-10 fold) following ischemia-reperfusion injuryMore likely to be disease-promoting in kidneys
HAS3PresentUnchanged across injury modelsUndetermined role in kidney disease

In kidney injury models, Has2 mRNA expression shows significantly higher induction compared to Has1 . Following ischemia-reperfusion injury (IRI), Has2 mRNA expression increases 9-10 fold, but this increase is attenuated in animals with ischemic preconditioning (IPC) prior to IRI, suggesting that HAS2 is more likely to be disease-promoting in the kidneys than HAS1 . In contrast, Has3 mRNA expression remains unchanged across different experimental conditions . Immunofluorescence detection reveals that HAS2 protein is not typically identified in the renal cortex of normal kidneys but shows noticeable increases in interstitial expression following injury .

What methodological approaches can be used to study the relative contributions of different HAS isoforms?

To investigate the specific contributions of individual HAS isoforms to hyaluronan synthesis and function, researchers can employ several methodological approaches:

  • Isoform-specific gene knockdown: Using siRNA targeting specific HAS isoforms (e.g., HAS1, assay ID 119443; HAS2, s6458) allows for selective reduction of individual isoform expression and assessment of the resulting phenotypic changes .

  • Adenoviral vectors for enforced expression: Constructing adenoviral vectors for enforced expression of specific HAS isoforms (e.g., HAS1 and HAS2) enables gain-of-function studies to determine the effects of individual isoforms .

  • Quantitative PCR for isoform-specific mRNA expression: Measuring the relative levels of mRNA for each HAS isoform provides insights into their differential expression patterns in various tissues and disease states .

  • Immunofluorescence with isoform-specific antibodies: Dual-staining approaches comparing the localization of HAS isoforms with other markers (e.g., α-SMA for myofibroblasts) can reveal cell type-specific expression patterns and associations with disease processes .

  • Functional assays following isoform manipulation: After specific knockdown or overexpression of individual HAS isoforms, researchers can assess changes in hyaluronan production, molecular weight distribution, and biological effects.

These approaches allow researchers to dissect the specific contributions of each HAS isoform to hyaluronan synthesis and its various biological functions in different physiological and pathological contexts.

What are the current challenges in studying HAS2 structure-function relationships?

Despite significant progress in understanding HAS2 function, several challenges remain in elucidating its structure-function relationships:

  • Obtaining high-resolution structural data: As a membrane-integrated enzyme, HAS2 presents challenges for crystallization and structural determination by traditional methods.

  • Understanding the dual glycosyltransferase mechanism: The bifunctional nature of HAS2, which catalyzes the addition of two different monosaccharides via different glycosidic linkages, represents a unique enzymatic capability that breaks the "one enzyme/one sugar transferred" dogma .

  • Elucidating the membrane translocation mechanism: The process by which HAS2 simultaneously synthesizes and translocates the growing hyaluronan chain across the membrane remains incompletely understood.

  • Identifying regulatory binding partners: The identification and characterization of proteins that interact with HAS2 and modulate its activity or localization represent important areas for future research.

  • Developing specific inhibitors: The development of isoform-specific inhibitors of HAS enzymes would provide valuable tools for dissecting their individual functions and potential therapeutic applications.

Addressing these challenges will require interdisciplinary approaches combining advanced structural biology techniques, molecular dynamics simulations, biochemical assays, and cellular studies.

How can recombinant HAS2 be utilized for biotechnological applications?

The successful expression of active recombinant HAS2 opens numerous possibilities for biotechnological applications:

  • Production of defined hyaluronan oligomers: Engineered HAS2 has demonstrated the ability to synthesize a mixture of hyaluronan oligomers (from 8-mer to 16-mer), which could serve as valuable tools for basic research and potential therapeutic applications .

  • Enzymatic synthesis of hyaluronan-based biomaterials: Recombinant HAS2 could enable the in vitro synthesis of hyaluronan with controlled molecular weight and modifications for tissue engineering and drug delivery applications.

  • Development of high-throughput screening assays: Active recombinant HAS2 could be used to develop screening assays for modulators of hyaluronan synthesis, potentially leading to novel therapeutic agents.

  • Creation of functional carbohydrates for medicinal purposes: Large-scale production of engineered recombinant HASs using E. coli provides practical and economic advantages for manufacturing enzymes used in the synthesis of various oligomeric hyaluronan molecules with potential medical applications .

The large-scale production of hyaluronan polymers and oligomers using recombinant HAS2 represents a powerful tool both for basic studies and for new biotechnology approaches to create functional carbohydrates for medicinal purposes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.