Recombinant Human Hyaluronan synthase 3 (HAS3)

Shipped with Ice Packs
In Stock

Description

Oncogenic Roles and Mechanisms

Overexpression of recombinant HAS3 drives tumor progression via:

HA-Dependent Pathways

  • Tumor Microenvironment Remodeling: HA accumulation disrupts cell-cell adhesion (E-cadherin/β-catenin loss) and promotes hypoxia .

  • Monocyte Recruitment: Secreted HA upregulates MCP-1, enhancing transendothelial monocyte migration (2.5-fold increase vs. controls) .

Signaling Activation

  • EGFR-SRC Axis: HA binding activates SRC (Y419 phosphorylation) and EGFR (Y845 phosphorylation), driving oral cancer invasion (P < 0.01) .

  • NF-κB Loop: TNF-α induces HAS3 transcription via NF-κB binding to its promoter, creating a feedforward loop in nasopharyngeal carcinoma .

Therapeutic Targeting

  • 4-Methylumbelliferone (4-MU): Inhibits HAS3 activity, reducing HA synthesis by 60–80% and suppressing migration/invasion in vitro .

  • PEGPH20 (pegylated hyaluronidase): Cleaves extracellular HA, slowing xenograft tumor growth by 40–50% .

Clinical Correlations

  • Prognostic Marker: High HAS3 mRNA correlates with poor survival in head/neck squamous cell carcinoma (HR = 1.8, P = 0.0087) .

  • Metastasis: Lymph node-positive tumors show 3.2-fold higher HAS3/TNF-α co-expression vs. node-negative cases .

Research Applications

Recombinant HAS3 is critical for:

  • Enzymatic Studies: Measuring UDP-sugar kinetics (Kₘ = 0.43 mM for UDP-GlcA) .

  • Posttranslational Analysis: Phosphorylation mapping using radiolabeling (³²P) and kinase inhibitors .

  • Drug Screening: Evaluating HA synthase inhibitors in cancer models .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
HAS3; Hyaluronan synthase 3; Hyaluronate synthase 3; Hyaluronic acid synthase 3; HA synthase 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-553
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
HAS3
Target Protein Sequence
MPVQLTTALRVVGTSLFALAVLGGILAAYVTGYQFIHTEKHYLSFGLYGAILGLHLLIQS LFAFLEHRRMRRAGQALKLPSPRRGSVALCIAAYQEDPDYLRKCLRSAQRISFPDLKVVM VVDGNRQEDAYMLDIFHEVLGGTEQAGFFVWRSNFHEAGEGETEASLQEGMDRVRDVVRA STFSCIMQKWGGKREVMYTAFKALGDSVDYIQVCDSDTVLDPACTIEMLRVLEEDPQVGG VGGDVQILNKYDSWISFLSSVRYWMAFNVERACQSYFGCVQCISGPLGMYRNSLLQQFLE DWYHQKFLGSKCSFGDDRHLTNRVLSLGYRTKYTARSKCLTETPTKYLRWLNQQTRWSKS YFREWLYNSLWFHKHHLWMTYESVVTGFFPFFLIATVIQLFYRGRIWNILLFLLTVQLVG IIKATYACFLRGNAEMIFMSLYSLLYMSSLLPAKIFAIATINKSGWGTSGRKTIVVNFIG LIPVSIWVAVLLGGLAYTAYCQDLFSETELAFLVSGAILYGCYWVALLMLYLAIIARRCG KKPEQYSLAFAEV
Uniprot No.

Target Background

Function
Hyaluronan synthase 3 (HAS3) is an enzyme that catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. This process is critical for the synthesis of hyaluronan, a major component of most extracellular matrices. Hyaluronan plays a structural role in tissue architecture and regulates cell adhesion, migration, and differentiation. HAS3 is one of several isozymes responsible for this reaction.
Gene References Into Functions
  1. Research indicates that HAS3 is induced by IL-1beta in vascular smooth muscle cells and is crucial in early macrophage-driven inflammation. PMID: 28987865
  2. miR-29a-3p can inhibit gastric cancer cell proliferation and metastasis by regulating HAS3 expression. These findings suggest a new mechanism by which miR-29a-3p may act as a potential tumor suppressor. PMID: 29693123
  3. Hyaluronan synthase 3 (HAS3) and tumor necrosis factor-alpha (TNF-alpha) exhibit an inter-regulatory loop that enhances tumorigenesis in oral cancer. PMID: 28107185
  4. Studies reveal novel regulatory mechanisms governed by UDP-sugars in hyaluronan synthesis, specifically the intracellular trafficking and extracellular shedding of HAS3. These mechanisms highlight the significance of these glucose metabolites in hyaluronan synthesis, which is particularly important in the interactions of malignant cells with their microenvironment and, consequently, tumor progression, such as in melanoma. PMID: 26883802
  5. Overexpression of HAS3 decreased ERK1/2 phosphorylation, suggesting that inhibition of MAP-kinase signaling is responsible for reduced melanoma cell adhesion, migration, and proliferation. PMID: 26222208
  6. HAS3 underexpression is associated with advanced tumor stage and adverse pathological features. This association implies inferior clinical outcomes for patients with both UTUCs and UBUCs, suggesting its critical role in tumor progression. PMID: 25934334
  7. Hyaluronan accumulation by HAS3 promotes pancreatic cancer growth. PMID: 25147816
  8. Transcriptional factor binding analysis indicates that the HAS3 gene promoter lacks a canonical TATA box but contains a classical GC box as well as other putative binding sites for transcriptional factors. PMID: 25843802
  9. HAS3 mRNA expression levels are elevated in atopic dermatitis lesions compared to healthy and non-lesional skin. PMID: 24658508
  10. Rab10 silencing increased the plasma membrane residence of HAS3, leading to a significant increase in hyaluronan secretion and an enlarged cell surface HA coat. Conversely, Rab10 overexpression suppressed hyaluronan synthesis. PMID: 24509846
  11. Hyaluronan (HA) produced by HAS3 is a ubiquitous component of the extracellular matrix and plays an active role in tissue remodeling. Additionally, HA is known to reduce reactive oxygen species (ROS)-induced cardiac injury. PMID: 24470002
  12. Nodular basal cell carcinoma is associated with increased levels of hyaluronic acid, concurrent with upregulation of gene expression of HAS3, HYAL3, and RHAMM, compared to normal adjacent skin. PMID: 20849445
  13. Data show that mRNA of HAS isoform 3 (HAS3) is upregulated in ESCC biopsies. PMID: 21429221
  14. Hyaluronan and HAS3 function in the growth and progression of colon carcinoma. PMID: 14566823

Show More

Hide All

Database Links

HGNC: 4820

OMIM: 602428

KEGG: hsa:3038

STRING: 9606.ENSP00000304440

UniGene: Hs.592069

Protein Families
NodC/HAS family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is HAS3 and how does it differ from other hyaluronan synthase isoforms?

Hyaluronan synthase 3 (HAS3) is one of three homologous enzymes (along with HAS1 and HAS2) responsible for synthesizing hyaluronan, a ubiquitous component of vertebrate extracellular and cell-associated matrices. While all three isoenzymes catalyze the same basic reaction, they differ in several critical aspects:

  • Enzymatic activity: HAS3 has a higher V<sub>max</sub> than HAS1 and HAS2, potentially contributing disproportionately to cellular hyaluronan production

  • Product size: HAS3 typically produces shorter hyaluronan polymers (10<sup>5</sup>-10<sup>6</sup> Da) compared to the several megadalton polymers produced by HAS1 and HAS2

  • Tissue distribution: The three isoforms show differential expression patterns across tissues and developmental stages

  • Regulation: Each isoform responds differently to various signaling pathways and stimuli

What are the molecular characteristics of recombinant HAS3?

Recombinant human HAS3 has been successfully expressed in various systems, with the following key characteristics:

  • Structure: A membrane-bound glycosyltransferase with multiple transmembrane domains that create a pore for hyaluronan translocation

  • Molecular weight: Approximately 63 kDa

  • Post-translational modifications: Undergoes serine phosphorylation, which can be enhanced by various effectors

  • Tagging options: Can be expressed with epitope tags such as FLAG (DYKDDDDK) for purification and detection

  • Activity requirements: Requires UDP-GlcUA (UDP-glucuronic acid) and UDP-GlcNAc (UDP-N-acetylglucosamine) as substrates

How should researchers design experiments to study HAS3 phosphorylation?

When investigating HAS3 phosphorylation, a well-designed experimental approach should include:

Basic experimental design:

  • Expression system selection: Use COS-7 cells or similar mammalian expression systems for recombinant FLAG-tagged HAS3 expression

  • Radiolabeling: Incorporate [32P]Pi for direct detection of phosphorylation events

  • Stimulation conditions: Include both unstimulated controls and cells treated with phosphorylation enhancers (e.g., 8-(4-chlorophenylthio)-cAMP)

  • Controls: Include a FLAG-tagged phosphorylated reference protein (such as one derived from EGFP) to estimate phosphorylation stoichiometry

Advanced considerations:

  • Time-course experiments: Monitor phosphorylation changes over multiple timepoints

  • Phosphatase inhibitors: Include appropriate inhibitors in lysis buffers to preserve phosphorylation status

  • Site-directed mutagenesis: Mutate potential phosphorylation sites to confirm specific residues involved

  • Mass spectrometry: Employ phosphoproteomic analysis to identify and quantify phosphorylation sites

Experimental variables to control:

  • Cell density and passage number

  • Transfection efficiency

  • Protein expression levels

  • Metabolic state of cells

What controls are essential when studying recombinant HAS3 activity in vitro and in vivo?

Control TypeIn Vitro StudiesIn Vivo Studies
Negative Controls- Empty vector-transfected cells
- Enzymatically inactive HAS3 mutant
- No-enzyme reactions
- Non-HAS3 expressing cells
- Vector-only controls
- Inactive HAS3 mutant expression
Positive Controls- Known active HAS isoform (e.g., HAS2)
- Previously validated HAS3 construct
- Established HAS3-overexpressing model
- Known hyaluronan-producing tissue
Substrate Controls- Varying UDP-GlcUA and UDP-GlcNAc concentrations
- Substrate quality verification
- Metabolic precursor availability assessment
Specificity Controls- Hyaluronidase digestion
- Specific HAS3 inhibitors
- Hyaluronidase treatment
- Conditional HAS3 expression
Technical Controls- Storage and handling conditions
- Detergent effects on enzyme activity
- Animal age and gender matching
- Housing conditions standardization

This comprehensive control strategy ensures reliable interpretation of experimental results by accounting for variables that could affect HAS3 activity measurements .

How can researchers effectively study the phosphorylation-dependent regulation of HAS3 activity?

To investigate how phosphorylation modulates HAS3 activity, researchers should implement a multi-faceted approach:

  • Correlation analysis:

    • Measure HAS3 phosphorylation stoichiometry under various conditions using reference proteins as standards

    • Simultaneously measure hyaluronan production using methods such as ELISA or labeled precursor incorporation

    • Establish statistical correlations between phosphorylation levels and enzymatic activity

  • Phosphomimetic and phosphodeficient mutants:

    • Generate serine-to-alanine mutations (phosphodeficient) at potential phosphorylation sites

    • Create serine-to-aspartate or serine-to-glutamate mutations (phosphomimetic)

    • Compare activity of these mutants to wild-type HAS3 under various stimulation conditions

  • Kinase and phosphatase modulation:

    • Apply specific activators and inhibitors of protein kinase A (PKA), as cAMP analogs significantly enhance HAS3 phosphorylation

    • Test effects of protein kinase C (PKC) modulation, as PMA can elevate HAS3 phosphorylation by approximately 50%

    • Examine phosphatase inhibitors (e.g., okadaic acid for PP1/PP2A) to assess phosphorylation dynamics

  • Structural analysis:

    • Integrate data with recent structural insights into HA synthase functioning

    • Analyze how phosphorylation might affect the conformation of channel-lining residues

The stoichiometry of FLAG-HAS3 phosphorylation increases from approximately 0.11 in unstimulated cells to as much as 0.32 in cells stimulated with cAMP analogs , providing a quantitative benchmark for these studies.

What methodological approaches are recommended for investigating the role of HAS3 in cancer progression?

Investigating HAS3's role in cancer requires a strategic experimental approach spanning multiple scales of analysis:

Cellular-level methods:

  • Establish stable HAS3-overexpressing cancer cell lines (e.g., BxPC-3 pancreatic cancer cells)

  • Measure hyaluronan synthesis using metabolic labeling or ELISA

  • Assess cell migration, invasion, and resistance to therapy

  • Analyze epithelial-mesenchymal transition markers (E-cadherin, β-catenin)

Animal model approaches:

  • Generate xenograft tumors with HAS3-overexpressing cells

  • Monitor tumor growth rates and invasiveness

  • Test hyaluronidase treatment (e.g., PEGPH20) to examine hyaluronan-dependent effects

  • Analyze tumor microenvironment changes (hypoxia, immune infiltration)

Clinical correlation studies:

  • Examine HAS3 expression in patient tumor samples

  • Correlate expression with hyaluronan content, tumor grade, and patient outcomes

  • Analyze post-translational modifications of HAS3 in patient samples

Research has shown that HAS3 overexpression leads to faster-growing xenograft tumors with abundant extracellular hyaluronan accumulation, while hyaluronidase treatment significantly decreases tumor growth rate . Additionally, hyaluronan accumulation correlates with disruption of adherens junctions, indicated by loss of membrane E-cadherin and cytoplasmic accumulation of β-catenin .

How can researchers address variability in HAS3 activity measurements across different experimental systems?

Researchers frequently encounter variability in HAS3 activity measurements due to several factors. The following methodological approaches can help standardize results:

  • Expression system optimization:

    • Test multiple cell lines to identify optimal expression systems

    • Establish stable cell lines rather than relying on transient transfection

    • Quantify actual HAS3 protein levels (not just mRNA) in each system

  • Substrate availability standardization:

    • Ensure consistent UDP-GlcUA and UDP-GlcNAc concentrations

    • Consider supplementing glucose or glucosamine to increase substrate availability, as HAS3 activity is highly dependent on precursor levels

    • Monitor and report cellular UDP-sugar pools in experimental conditions

  • Assay method validation:

    • Employ multiple detection methods for hyaluronan production (e.g., ELISA, radiolabeling, Stains-all staining of agarose gels)

    • Include internal standards for quantification

    • Develop calibration curves for each detection method

  • Environmental variables control:

    • Maintain consistent temperature, pH, and ionic conditions

    • Report detailed buffer compositions and reaction conditions

    • Control for cell density and culture conditions

  • Statistical approach:

    • Perform sufficient biological and technical replicates (minimum n=8 for enzymatic assays)

    • Use appropriate statistical tests for comparing activity across conditions

    • Consider developing a standardized activity unit based on reference materials

What are the critical considerations when investigating the structure-function relationship of channel-lining residues in HAS3?

Recent structural insights into hyaluronan synthases have revealed the importance of channel-lining residues in modulating hyaluronan translocation and product length distribution . When investigating these structure-function relationships in HAS3, researchers should consider:

  • Mutagenesis strategy:

    • Target conserved residues identified in structural studies, particularly:

      • The WGTSGRR/K motif, which is critical for enzyme function

      • Methionine-rich hydrophobic regions that may form a translocation channel

      • Charged residues that interact with the growing hyaluronan chain

    • Create conservative substitutions (e.g., W→F, R→K) and more disruptive changes (e.g., W→A, R→A)

    • Design multiple mutations to test additive or synergistic effects

  • Functional assessments:

    • Measure both reaction kinetics (UDP release) and product characteristics (hyaluronan size distribution)

    • Compare short-term (1 hour) versus long-term (8+ hours) synthesis reactions

    • Analyze hyaluronan product by multiple methods (gel electrophoresis, size exclusion chromatography)

  • Structural validation:

    • Consider obtaining structural information through cryo-EM or other structural biology approaches

    • Model mutations based on existing structural data

    • Examine potential conformational changes upon substrate binding or product translocation

  • Comparative analysis:

    • Compare results to other HAS isoforms (HAS1, HAS2) and evolutionary distant orthologues

    • Consider the unique aspects of HAS3-produced hyaluronan and its biological significance

Research has demonstrated that specific mutations in the gating loop (e.g., W491A) can abolish HAS3 activity, while others (T493A, T493S) reduce catalytic rate to 20-25% but produce longer hyaluronan chains . These findings highlight how subtle changes in channel architecture can dramatically affect both enzyme activity and product characteristics.

What emerging technologies and approaches might advance our understanding of HAS3 regulation and function?

Several cutting-edge technologies hold promise for deepening our understanding of HAS3:

  • Advanced structural biology techniques:

    • Cryo-electron microscopy to capture HAS3 in different conformational states during hyaluronan synthesis

    • Single-particle analysis to study the dynamics of hyaluronan translocation

    • Hydrogen-deuterium exchange mass spectrometry to analyze conformational changes upon phosphorylation

  • High-throughput screening approaches:

    • CRISPR-Cas9 screens to identify novel regulators of HAS3 activity

    • Small molecule libraries to discover specific HAS3 modulators

    • Synthetic biology approaches to create HAS3 variants with novel properties

  • Advanced imaging technologies:

    • Super-resolution microscopy to visualize HAS3 distribution and trafficking

    • Live-cell imaging with fluorescently tagged hyaluronan to monitor synthesis in real time

    • Correlative light and electron microscopy to connect HAS3 localization with ultrastructural features

  • Systems biology integration:

    • Multi-omics approaches combining proteomics, metabolomics, and glycomics

    • Mathematical modeling of hyaluronan synthesis and degradation networks

    • Network analysis of HAS3 interactions with other cellular components

  • Translational research innovations:

    • Patient-derived organoids to study HAS3 in disease contexts

    • Glycoengineering approaches to modulate hyaluronan production

    • Targeted delivery systems for HAS3 modulators in therapeutic applications

How might contradictory findings regarding HAS3 phosphorylation and activity be reconciled through experimental design?

Contradictory findings in HAS3 research can stem from methodological differences, biological variability, or contextual factors. An optimized experimental design can help reconcile these contradictions:

For example, apparent contradictions in the role of PKA versus PKC in HAS3 regulation could be resolved by recognizing that HAS3 might be a substrate for both kinases acting at distinct sites, as suggested by preliminary experiments with the PKA-selective inhibitor H-89, which showed greater inhibition of cAMP-stimulated phosphorylation than basal or PMA-stimulated phosphorylation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.