Recombinant Human Hydroxycarboxylic acid receptor 3 (HCAR3)

Shipped with Ice Packs
In Stock

Description

Production and Recombinant Forms

Recombinant HCAR3 is synthesized using diverse expression systems to optimize solubility and functionality:

Expression SystemTags/ConjugatesApplicationsSource
Wheat GermNon-taggedFunctional studies, antibody production
E. coliGST-tagged, Avi-tagCompound screening, biotinylation assays
YeastNon-taggedStructural studies
BaculovirusFull-lengthMembrane protein reconstitution
Mammalian CellsFull-lengthNative conformation studies

Storage conditions vary: -80°C for long-term preservation, with short-term storage at -20°C .

Biological Functions and Signaling Pathways

HCAR3 regulates metabolic and immune processes via Gαi/o-mediated signaling:

Metabolic Regulation

  • Adipocyte Lipolysis: Inhibits cAMP production, counteracting β-adrenergic receptor-stimulated lipolysis. This is mediated by β-oxidation intermediates like 3-hydroxyoctanoic acid, which act as endogenous agonists .

  • Energy Homeostasis: Modulates fatty acid oxidation flux under fasting or diabetic conditions .

Immune and Epithelial Functions

  • Keratinocyte Migration: HCAR3 knockdown reduces wound closure efficiency by 30–50%, while overexpression enhances migration .

  • Immune Cell Activation: Increases intracellular Ca²⁺ levels in macrophages and neutrophils, influencing inflammatory responses .

Research Applications and Functional Insights

HCAR3 is utilized in studies targeting metabolic disorders, wound healing, and immune modulation:

ApplicationKey FindingsSource
Lipolysis Modulation3-Hydroxyoctanoic acid agonism inhibits lipolysis in adipocytes via Gαi signaling
Wound HealingHCAR3 knockdown reduces keratinocyte migration and E-cadherin membrane localization
Immune ResponseKynurenic acid activation of HCAR3 modulates macrophage responses and PPARγ activation
Compound ScreeningNiacin (low-affinity ligand) induces antilipolytic effects at high doses

Disease Associations and Therapeutic Potential

HCAR3 is implicated in conditions linked to metabolic and immune dysregulation:

Disease/ConditionRole of HCAR3Source
Diabetic KetoacidosisPotential target for suppressing excessive lipolysis via 3-OH-octanoic acid agonism
Skin DisordersRegulates keratinocyte migration and adhesion, critical for wound repair
Immune DisordersModulates inflammatory responses in immune cells via Ca²⁺ signaling

Challenges and Future Directions

  • Species Specificity: HCAR3 is absent in rodent models, complicating in vivo studies .

  • Therapeutic Development: Agonists like 3-hydroxyoctanoic acid or kynurenic acid may offer novel treatments for metabolic or immune disorders .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific requirements for the format, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult with your local distributor for the specific delivery timeframe.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
HCAR3; GPR109B; HCA3; HM74B; NIACR2; Hydroxycarboxylic acid receptor 3; G-protein coupled receptor 109B; G-protein coupled receptor HM74; G-protein coupled receptor HM74B; Niacin receptor 2; Nicotinic acid receptor 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-387
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MNRHHLQDHFLEIDKKNCCVFRDDFIAKVLPPVLGLEFIFGLLGNGLALWIFCFHLKSWK SSRIFLFNLAVADFLLIICLPFVMDYYVRRSDWKFGDIPCRLVLFMFAMNRQGSIIFLTV VAVDRYFRVVHPHHALNKISNWTAAIISCLLWGITVGLTVHLLKKKLLIQNGPANVCISF SICHTFRWHEAMFLLEFLLPLGIILFCSARIIWSLRQRQMDRHAKIKRAITFIMVVAIVF VICFLPSVVVRIRIFWLLHTSGTQNCEVYRSVDLAFFITLSFTYMNSMLDPVVYYFSSPS FPNFFSTLINRCLQRKMTGEPDNNRSTSVELTGDPNKTRGAPEALMANSGEPWSPSYLGP TSNNHSKKGHCHQEPASLEKQLGCCIE
Uniprot No.

Target Background

Function
Hydroxycarboxylic acid receptor 3 (HCAR3) acts as a receptor for 3-OH-octanoid acid. This receptor plays a crucial role in regulating adipocyte lipolysis, mediating a negative feedback mechanism to counteract prolipolytic influences arising from physiological or pathological increases in beta-oxidation rates. HCAR3 also functions as a low-affinity receptor for nicotinic acid. This pharmacological effect requires nicotinic acid doses that are significantly higher than those found in a typical diet.
Gene References Into Functions
  1. Provides insights into the G protein coupling profiles of HCA receptors and elucidates the function of the receptor's C terminus PMID: 26656756
  2. Demonstrates the essential role of HCAR1/3 in maintaining lipid/fatty acid metabolism equilibrium within breast cancer cells. PMID: 25839160
  3. Highlights the activation of HCAR3 signaling to MAP kinase cascades via the PLC-dependent PKC and MMP-mediated EGFR pathways PMID: 22289163
  4. In contrast, in a squamous cell carcinoma-derived cell line, both GPR109A and GPR109B exhibit a more diffuse cellular localization and demonstrate reduced functionality. PMID: 21655214
  5. Provides evidence suggesting that GPR109A and GPR109B dimerization is a constitutive process that occurs early during biosynthesis. PMID: 20380810
  6. Identifies HM74 as a nicotinic acid receptor, demonstrating its high expression in adipose tissue. PMID: 12563315
  7. Suggests that aromatic D-amino acids induce a chemotactic response in human neutrophils through activation of GPR109B. PMID: 19237584
  8. Reveals a significant association between an A allele in HM74 and both schizophrenia and the combined occurrence of schizophrenia and bipolar disorder. PMID: 19502010
  9. Concludes that the ligand-receptor pair 3-OH-octanoic acid/GPR109B mediates negative feedback regulation of adipocyte lipolysis in humans but not in mice. PMID: 19561068
  10. Demonstrates that the coordinated PPARgamma-mediated regulation of GPR81, GPR109A, and GPR109B presents a novel mechanism by which TZDs may reduce circulating free fatty acid levels and potentially improve insulin resistance in obese individuals. PMID: 19633298

Show More

Hide All

Database Links

HGNC: 16824

OMIM: 606039

KEGG: hsa:8843

STRING: 9606.ENSP00000436714

UniGene: Hs.458425

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expression largely restricted to adipose tissue and spleen.

Q&A

What is HCAR3 and why is it significant for research?

HCAR3 (Hydroxycarboxylic Acid Receptor 3) is a G protein-coupled receptor encoded by the human genome that functions as a metabolite sensor. It belongs to the HCAR family, which includes HCAR1 (GPR81), HCAR2 (GPR109A), and HCAR3 (GPR109B). HCAR3 is particularly significant because it is exclusive to humans and higher primates, making it both challenging to study and potentially valuable as a therapeutic target for modulating cellular metabolism and immune responses . Unlike many other GPCRs, HCAR3 remains relatively understudied despite its therapeutic potential, positioning it as an important target for new drug discovery efforts .

How does HCAR3 differ from other HCAR family members?

Among the three HCAR family members in humans (HCAR1, HCAR2, and HCAR3), HCAR3 is unique in being exclusive to humans and higher primates . This species specificity has made it difficult to establish clear biological functions using typical animal models. While HCAR3 shares similar expression patterns with HCAR2 in immune cells and adipocytes, it has distinct ligand binding properties and potentially specialized functions . The evolutionary restriction of HCAR3 to higher primates suggests it may have evolved to serve specialized metabolic and immunological functions unique to these species .

What are the major challenges in HCAR3 research?

The primary challenges in HCAR3 research include:

  • Species restriction to humans and higher primates, limiting relevant animal model availability

  • Lack of experimental structures for any hydroxycarboxylic acid receptor family members, including HCAR3

  • Limited knowledge about specific endogenous ligands and their physiological concentrations

  • Difficulty in distinguishing HCAR3-specific functions from those of the closely related HCAR2

  • Need for specialized methodologies to study receptor signaling in native cell environments

  • Absence of selective pharmacological tools, particularly HCAR3 inhibitors

Where is HCAR3 predominantly expressed in human tissues?

HCAR3 is predominantly expressed in two major cell types:

  • Immune cells, particularly neutrophils and macrophages

  • Adipocytes (fat cells)

This expression pattern suggests a dual role in mediating metabolic and immunological responses . Unlike many GPCRs with broad expression patterns, HCAR3's restricted expression provides important clues about its physiological functions and potential as a therapeutic target. The receptor's expression in immune cells specifically points to its involvement in inflammatory processes and immune regulation, while adipocyte expression indicates roles in lipid metabolism and energy homeostasis .

How can researchers reliably detect HCAR3 expression in tissue samples?

For reliable detection of HCAR3 expression in tissue samples, researchers should employ a combination of techniques:

  • RT-qPCR: Using HCAR3-specific primers to quantify mRNA expression levels, with careful primer design to distinguish from the closely related HCAR2

  • Western blotting: With validated anti-HCAR3 antibodies, noting potential cross-reactivity with HCAR2

  • Immunohistochemistry/Immunofluorescence: For spatial localization within tissues

  • RNA sequencing: For comprehensive expression profiling

  • Single-cell RNA sequencing: To determine cell-type specific expression patterns

To address potential issues with antibody specificity, validation using recombinant HCAR3 proteins as positive controls is essential . Additionally, genetic approaches using CRISPR-based gene tagging can provide higher specificity when antibody-based approaches are unreliable.

What are the primary signaling pathways activated by HCAR3?

HCAR3 primarily signals through G i/o-type G proteins, which modulate distinct second messenger pathways in different cell types :

Cell TypePrimary Signaling EffectMolecular MechanismDownstream Consequences
AdipocytesInhibition of lipolysisInhibition of adenylyl cyclase → decreased cAMPSuppression of hormone-stimulated lipolysis
Immune cellsImmunomodulatory effectsIncreased intracellular Ca²⁺Altered immune cell function

In adipocytes, HCAR3 signaling serves to counteract cAMP-stimulating metabolic hormone signals mediated by G s-coupled receptors like the β2-adrenergic receptor . This creates a regulatory feedback mechanism for metabolic control. The distinct signaling outcomes in different cell types highlight the context-dependent nature of HCAR3 function.

How do researchers differentiate between HCAR3-specific signaling and signaling through related receptors?

Differentiating HCAR3-specific signaling from related receptors requires several methodological approaches:

  • Use of receptor-selective ligands: Employ compounds with established selectivity profiles for HCAR3 over HCAR1/HCAR2

  • Genetic approaches:

    • CRISPR-mediated knockout or knockdown of HCAR3

    • Selective overexpression of HCAR3 in model systems

  • Pharmacological profiling with concentration-response curves to identify receptor-specific potencies

  • Chimeric receptor approach: Create chimeric receptors with components from different HCAR family members to identify domains responsible for specific signaling outcomes

  • High-throughput screening platforms like DCyFIR can help determine ligand specificity by testing against multiple receptors simultaneously

When interpreting results, researchers should consider potential receptor heteromerization and cross-talk between signaling pathways.

What are the known endogenous agonists of HCAR3 and their physiological relevance?

Two primary endogenous agonists of HCAR3 have been identified, each with distinct physiological contexts:

Endogenous AgonistMetabolic OriginPhysiological ContextProposed Function
3-Hydroxyoctanoic acid (3-OH)β-oxidation intermediateFasting, diabetic ketoacidosisNegative feedback regulator of lipolysis
Kynurenic acid (KYNA)Kynurenine pathway of tryptophan degradationInflammatory conditionsImmunomodulatory effects

The identification of 3-OH as an HCAR3 agonist suggests that the receptor plays a role in a negative feedback loop that counteracts excessive lipolysis during periods of fatty acid metabolism . KYNA activation of HCAR3 appears to control a separate negative feedback loop that suppresses ongoing immune responses, potentially contributing to immune tolerance or resolution of inflammation . This dual ligand specificity suggests HCAR3 may integrate metabolic and immune signaling.

How can researchers develop selective synthetic agonists and antagonists for HCAR3?

Developing selective synthetic compounds for HCAR3 requires multi-faceted approaches:

  • Structure-activity relationship (SAR) studies:

    • While no experimental structures exist for HCAR3 , computational modeling can help predict binding sites

    • Systematic modification of known ligands (3-OH, KYNA) to improve selectivity

    • Fragment-based drug design to identify novel chemical scaffolds

  • High-throughput screening approaches:

    • Use of platforms like DCyFIR to screen compound libraries against HCAR3 and related receptors simultaneously

    • Counter-screening against HCAR1 and HCAR2 to identify selective compounds

  • Evaluation criteria for candidate compounds:

    • Selectivity (>100-fold) over HCAR1/HCAR2

    • Appropriate physicochemical properties for intended applications

    • Functional characterization across multiple signaling pathways

    • Assessment in native cell contexts (adipocytes, immune cells)

  • Development of allosteric modulators:

    • Target non-orthosteric binding sites for greater selectivity

    • Design positive or negative modulators to fine-tune receptor responses

Why haven't structures been resolved for HCAR3, and what approaches could overcome these challenges?

As of current research, no experimental structures have been resolved for any hydroxycarboxylic acid receptor family members, including HCAR1-3 . This structural gap presents significant challenges for structure-based drug design. Several factors contribute to this limitation:

  • Technical challenges:

    • GPCRs are notoriously difficult to crystallize due to their inherent flexibility

    • Low expression levels and instability in detergent solutions

    • Multiple conformational states complicate structural determination

  • Promising approaches to overcome these limitations:

    • Cryo-electron microscopy (cryo-EM): Recent advances have enabled structure determination of GPCRs without crystallization

    • Stabilizing mutations or fusion proteins to enhance receptor stability

    • Nanobody or antibody fragments as crystallization chaperones

    • Lipid cubic phase crystallization methods specifically optimized for GPCRs

The recent breakthrough in determining HCAR2 structures through cryo-EM suggests that similar approaches might be successful for HCAR3. Computational approaches using homology modeling based on the HCAR2 structure could provide interim structural insights while experimental structures are being pursued.

How can researchers use computational modeling to predict HCAR3 structure and ligand binding?

In the absence of experimental structures, computational approaches offer valuable insights:

  • Homology modeling strategies:

    • Use the recently determined HCAR2 structure as a template

    • Incorporate evolutionary sequence conservation data

    • Refine models using molecular dynamics simulations

    • Validate using mutagenesis data where available

  • Ligand binding site prediction:

    • Molecular docking of known ligands (3-OH, KYNA) to identify key interactions

    • Fragment-based computational screening to explore binding pocket properties

    • Molecular dynamics simulations to capture receptor flexibility

  • Structure validation approaches:

    • In silico alanine scanning to predict critical ligand binding residues

    • Comparison with experimental mutagenesis data

    • Virtual screening performance against decoy compounds

  • Application to drug design:

    • Structure-based virtual screening of compound libraries

    • De novo design of compounds targeting predicted binding pockets

    • Rational design of selective compounds by targeting non-conserved residues between HCAR subtypes

What is the evidence linking HCAR3 to psychiatric disorders, particularly schizophrenia?

Recent research has established compelling links between HCAR3 and psychiatric disorders:

  • Genetic evidence:

    • The SNP rs2454721 in HCAR3 is significantly associated with niacin response in psychiatric patients

    • The risk allele T of rs2454721 affects niacin responses through elevated HCAR3 gene expression

    • HCAR3 has been identified as a novel schizophrenia susceptibility gene

  • Phenotypic evidence:

    • Blunted niacin response (BNR) is an established endophenotype of schizophrenia

    • HCAR3 expression alterations may underlie this blunted response

    • This suggests dysregulation of HCAR3 signaling pathways in schizophrenia

  • Potential mechanisms:

    • Altered immune signaling through HCAR3 may contribute to neuroinflammatory components of psychiatric disorders

    • Dysregulated tryptophan metabolism (involving KYNA) has been implicated in schizophrenia pathophysiology

    • Abnormal HCAR3 response to endogenous metabolites may disrupt normal brain function

This evidence positions HCAR3 as a significant target for further investigation in psychiatric disorders, potentially offering new therapeutic approaches .

How might HCAR3 be involved in metabolic disorders, and what therapeutic approaches could be developed?

HCAR3's role in metabolic regulation suggests several potential involvements in metabolic disorders:

  • Proposed metabolic functions and disorder associations:

    • Negative feedback regulation of lipolysis through 3-OH sensing

    • Integration of fatty acid metabolism signals with adipocyte function

    • Potential dysregulation in conditions of altered lipid metabolism (obesity, diabetes)

  • Therapeutic opportunities:

    • HCAR3 agonists could suppress excessive lipolysis in dyslipidemia

    • Modulators of HCAR3 signaling might regulate adipocyte function in metabolic syndrome

    • Integration of metabolic and immune functions offers unique therapeutic potential

  • Challenges in therapeutic development:

    • Need to delineate HCAR3-specific effects from HCAR2 effects

    • Potential immunomodulatory side effects of metabolically-targeted compounds

    • Species differences limiting preclinical model relevance

  • Metabolic research approaches:

    • Assessment of HCAR3 expression and signaling in adipose tissue from metabolic disease patients

    • Investigation of HCAR3 polymorphisms in metabolic disorder cohorts

    • Development of humanized model systems to overcome species limitations

What are the most effective expression systems for producing functional recombinant HCAR3?

For the production of functional recombinant HCAR3, several expression systems offer distinct advantages:

Expression SystemAdvantagesLimitationsBest Applications
Mammalian cell lines (HEK293, CHO)Native-like post-translational modifications, proper foldingHigher cost, lower yieldFunctional studies, ligand screening
Insect cells (Sf9, Hi5)Higher yields than mammalian cells, eukaryotic processingDifferent glycosylation patternsStructural biology, antibody generation
Yeast (P. pastoris, S. cerevisiae)Cost-effective, scalable, eukaryotic processingDifferent membrane compositionHigh-throughput screening systems like DCyFIR
Cell-free systemsRapid production, direct incorporation of modified amino acidsLimited post-translational modificationsPreliminary binding studies, mutational analysis

For functional studies, mammalian expression systems generally provide the most physiologically relevant HCAR3 protein. The DCyFIR yeast-based system offers particular advantages for high-throughput ligand discovery, allowing CRISPR integration of GPCRs directly into the yeast genome and multiplexed screening of receptor-ligand interactions .

Essential considerations for functional expression include:

  • Addition of appropriate signal sequences and tags

  • Codon optimization for the expression system

  • Temperature and induction optimization

  • Use of stabilizing additives during purification

  • Validation of function through ligand binding or signaling assays

What are the optimal assay methods for studying HCAR3 activation and signaling?

Studying HCAR3 activation and signaling requires carefully selected assay methods:

  • G protein-dependent signaling assays:

    • cAMP inhibition assays (HCAR3 couples to Gi/o)

    • GTPγS binding assays to measure G protein activation

    • BRET/FRET-based G protein dissociation assays for real-time measurements

    • Calcium mobilization assays (in immune cells)

  • G protein-independent signaling:

    • β-arrestin recruitment assays

    • Receptor internalization assays

    • ERK phosphorylation assays

  • Physiological function assays:

    • Lipolysis inhibition in adipocytes

    • Immune cell functional assays (cytokine production, migration)

    • Gene expression profiling following receptor activation

  • Advanced methodologies:

    • CRISPR-based reporter systems for endogenous signaling readouts

    • Multiplexed screening platforms like DCyFIR

    • Label-free technologies (impedance, SPR) for integrated responses

    • Phosphoproteomic analysis of signaling cascades

When designing these assays, researchers should consider potential cross-talk with other signaling pathways and validate findings across multiple assay platforms.

How can researchers address the species restriction of HCAR3 when developing translational models?

The species restriction of HCAR3 to humans and higher primates presents significant challenges for translational research . Researchers can address this limitation through several innovative approaches:

  • Humanized model systems:

    • CRISPR knock-in of human HCAR3 into rodent models

    • Transgenic mice expressing human HCAR3 under tissue-specific promoters

    • Patient-derived xenografts expressing native human HCAR3

  • In vitro alternatives:

    • Human primary cell cultures (adipocytes, immune cells)

    • Induced pluripotent stem cell (iPSC)-derived relevant cell types

    • Organoid models incorporating human HCAR3-expressing cells

    • Microphysiological systems ("organs-on-chips") with human cells

  • Computational approaches:

    • Systems biology modeling of HCAR3 pathway integration

    • Physiologically-based pharmacokinetic (PBPK) modeling to predict human responses

    • AI/ML approaches to translate findings between species

  • Non-human primate considerations:

    • Ethical evaluation of when NHP models are specifically justified

    • Careful selection of primate species expressing HCAR3 most similar to human variant

    • Minimally invasive approaches when NHP models are necessary

These approaches can help overcome the translational gap caused by HCAR3's species restriction, though each comes with methodological challenges requiring careful validation.

What are the current frontiers in HCAR3 research and promising future directions?

Current frontiers in HCAR3 research span multiple domains with several promising future directions:

  • Structural biology and drug discovery:

    • Determination of HCAR3 structure using cryo-EM, building on recent success with HCAR2

    • Development of the first selective HCAR3 inhibitors, currently lacking in the field

    • Design of biased ligands that selectively activate specific signaling pathways

  • Metabolite sensing and signaling:

    • Identification of additional endogenous ligands beyond 3-OH and KYNA

    • Elucidation of the integrated signaling networks connecting metabolism and immunity

    • Investigation of potential HCAR3-HCAR2 heterodimers and their functional significance

  • Psychiatric disorder connections:

    • Further investigation of HCAR3 as a schizophrenia susceptibility gene

    • Development of HCAR3-targeted therapies for psychiatric disorders with BNR

    • Exploration of connections between KYNA signaling, HCAR3, and neuroinflammation

  • High-throughput approaches:

    • Application of multiplexed GPCR screening technologies like DCyFIR

    • Metabolomic approaches to identify novel HCAR3 ligands

    • Development of AI-driven virtual screening specifically for HCAR3

  • Immune modulation:

    • Investigation of HCAR3's role in tumor immunology and potential as a cancer therapy target

    • Exploration of HCAR3 modulation for inflammatory disorders

    • Understanding of how KYNA-HCAR3 signaling regulates immune tolerance

These frontier areas represent significant opportunities for researchers to make fundamental discoveries about HCAR3 biology and develop novel therapeutic approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.