Recombinant Human Insulin-induced gene 1 protein (INSIG1)

Shipped with Ice Packs
In Stock

Description

Regulation of Cholesterol Biosynthesis

INSIG1 serves as a central regulator in the SREBP (Sterol Regulatory Element-Binding Protein) pathway, which controls cholesterol biosynthesis. Its primary mechanism involves binding to the sterol-sensing domain of SCAP (SREBP Cleavage-Activating Protein) . This interaction prevents the SCAP/SREBP complex from translocating from the ER to the Golgi apparatus, where SREBP would otherwise undergo proteolytic activation . By retaining this complex in the ER, INSIG1 effectively inhibits SREBP from functioning as a transcription factor for genes involved in cholesterol synthesis, including the HMG-CoA reductase gene .

Additionally, INSIG1 binds directly to the sterol-sensing domain of HMG-CoA reductase, the rate-limiting enzyme in cholesterol biosynthesis, promoting its degradation . Both of these regulatory functions utilize the same binding site on the INSIG1 protein, demonstrating the multifunctional nature of this regulatory molecule .

Potential Interactions with Other Proteins

Research has identified other proteins with sterol-binding sites similar to those of SCAP and HMG-CoA reductase that may also be regulated by INSIG1. These include:

  1. Niemann-Pick disease type C1 protein, which facilitates intracellular cholesterol movement

  2. Patched, the receptor for Hedgehog, a protein containing covalently bound cholesterol

These potential interactions suggest INSIG1 may have broader regulatory roles in cellular sterol trafficking and signaling pathways beyond its established functions in cholesterol biosynthesis.

Production of Recombinant Human INSIG1

Recombinant protein production involves the expression of a protein of interest in a heterologous system, followed by purification and characterization. While specific details for recombinant INSIG1 production are not explicitly described in the provided resources, the process would typically follow established protocols for membrane protein expression.

Expression Systems

For a transmembrane protein like INSIG1, several expression systems could be employed for recombinant production. By analogy with other recombinant proteins like insulin, which can be produced in HEK293T cells , appropriate expression systems for INSIG1 would likely include:

Table 1: Potential Expression Systems for Recombinant INSIG1 Production

Expression SystemAdvantagesChallenges for INSIG1
Mammalian (HEK293T)Proper folding and post-translational modificationsHigher cost, lower yield
Insect CellsGood for membrane proteins, higher yields than mammalianMay have differences in glycosylation
Bacterial (E. coli)High yield, cost-effectiveMembrane proteins often misfold, lack glycosylation
YeastGood for membrane proteins, eukaryotic processingMay have hypermannosylation

Purification Strategies

Purification of recombinant INSIG1 would require specialized approaches due to its hydrophobic transmembrane domains. Similar to the approach described for recombinant insulin , affinity chromatography using tagged versions of the protein followed by conventional chromatography steps would be effective for isolating pure INSIG1.

Inhibition of HIV-1 Production

One of the most intriguing discoveries about INSIG1 is its role in inhibiting HIV-1 replication, which represents a function distinct from its established role in cholesterol metabolism. Research has demonstrated that INSIG1 is upregulated during HIV-1 production but not during the initial infection process . This timing suggests INSIG1 functions inside cells rather than at the plasma membrane during viral infection .

The mechanism of HIV-1 inhibition by INSIG1 has been elucidated through experiments using pseudovirus production, protein overexpression, and gene knockouts. INSIG1 inhibits HIV-1 production specifically by accelerating the degradation of the HIV-1 Gag protein . Unlike its role in HMGCR degradation, which proceeds through the proteasome pathway, INSIG1 coordinates with the E3 ligase TRC8 (Translocation in Renal Carcinoma Chromosome 8) to promote Gag degradation through the lysosome pathway .

Experimental Evidence for Anti-HIV Function

Multiple lines of experimental evidence support INSIG1's role in HIV-1 inhibition:

Table 2: Experimental Evidence for INSIG1's Role in HIV-1 Inhibition

Experimental ApproachKey FindingReference
INSIG1 overexpressionReduced HIV-1 production and decreased Gag protein levels
INSIG1 knockout (CRISPR/Cas9)Increased HIV-1 production and accumulation of Gag protein
INSIG1 reintroduction in KO cellsRestored HIV-1 production to wild-type levels
Protein degradation assaysINSIG1 specifically degrades Gag but not Env or VSV-G proteins

These experimental data collectively establish INSIG1 as a critical cellular factor that functions as a "sentinel" responsive to HIV-1 production, inhibiting viral replication by targeting Gag for degradation in intracellular membrane compartments like the ER and endosomes, where both INSIG1 and Gag are localized .

Role in Non-alcoholic Steatohepatitis (NASH)

Beyond its antiviral properties, INSIG1 plays a complex role in metabolic disorders, particularly in non-alcoholic steatohepatitis (NASH). Research using Insig1 knockout mice has revealed that, contrary to what might be expected given its role in cholesterol regulation, loss of Insig1 function can have beneficial effects in NASH .

Studies have shown that despite enhanced lipid and cholesterol biosynthesis, Insig1 knockout mice exhibited similar systemic metabolism and insulin sensitivity to heterozygous and wild-type littermates . Furthermore, the activation of SREBPs in the absence of INSIG1 resulted in lipidome remodeling, decreased hepatocellular damage, and improved wound-healing responses .

Protective Effects in Hepatic Injury

The protective mechanism of INSIG1 deficiency in NASH appears to involve multiple pathways that prevent hepatic lipotoxicity. These include:

  1. Enhanced desaturase activity leading to lipid remodeling

  2. Multifaceted regulation of metabolic pathways

  3. Prevention of hepatic lipotoxicity despite increased lipid deposition

These findings suggest that the SCAP/SREBP/INSIG1 trio governs transcriptional programs aimed at protecting the liver from lipotoxic insults in NASH, highlighting the complexity of INSIG1's role in metabolic health beyond simple cholesterol regulation .

Comparative Analysis of INSIG1 Functions

Table 3: Multifunctional Roles of INSIG1 Protein

Functional AreaMechanismOutcomeReference
Cholesterol HomeostasisBinds SCAP to retain SREBP in ERDecreased cholesterol synthesis
Cholesterol HomeostasisBinds HMG-CoA reductaseIncreased degradation of the enzyme
HIV-1 InfectionCoordinates with TRC8 to degrade GagInhibition of HIV-1 production
NASH PathophysiologyLoss leads to SREBP activation and lipid remodelingProtection against hepatic lipotoxicity

This multifunctionality demonstrates that INSIG1 operates at the intersection of lipid metabolism, host defense, and metabolic disease pathways, making it a particularly interesting target for diverse therapeutic approaches.

Research Applications

Recombinant human INSIG1 has significant potential as a research tool to further investigate:

  1. Mechanisms of cholesterol homeostasis regulation

  2. Novel antiviral strategies against HIV-1 and potentially other viruses

  3. Therapeutic approaches for metabolic disorders like NASH

  4. Protein-protein interactions at the ER membrane

Therapeutic Potential

The diverse functions of INSIG1 suggest several potential therapeutic applications:

  1. Antiviral therapy: Enhancing INSIG1 function could potentially inhibit HIV-1 replication through the degradation of viral Gag protein.

  2. Metabolic disease modulation: Targeting the INSIG1 pathway could provide novel therapeutic strategies for NASH and other metabolic disorders.

  3. Cholesterol regulation: Modulation of INSIG1 activity could offer alternative approaches to managing cholesterol levels in hypercholesterolemia.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will prepare the product based on your specifications.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% of glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
INSIG1; Insulin-induced gene 1 protein; INSIG-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-277
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
INSIG1
Target Protein Sequence
MPRLHDHFWSCSCAHSARRRGPPRASAAGLAAKVGEMINVSVSGPSLLAAHGAPDADPAP RGRSAAMSGPEPGSPYPNTWHHRLLQRSLVLFSVGVVLALVLNLLQIQRNVTLFPEEVIA TIFSSAWWVPPCCGTAAAVVGLLYPCIDSHLGEPHKFKREWASVMRCIAVFVGINHASAK LDFANNVQLSLTLAALSLGLWWTFDRSRSGLGLGITIAFLATLITQFLVYNGVYQYTSPD FLYIRSWLPCIFFSGGVTVGNIGRQLAMGVPEKPHSD
Uniprot No.

Target Background

Function
Insulin-induced gene 1 (INSIG1) is an oxysterol-binding protein that plays a crucial role in regulating cholesterol synthesis by controlling both the endoplasmic reticulum (ER) to Golgi transport of SCAP (SREBP cleavage-activating protein) and the degradation of HMGCR (3-hydroxy-3-methylglutaryl-CoA reductase). It acts as a negative regulator of cholesterol biosynthesis by mediating the retention of the SCAP-SREBP complex in the ER, thereby preventing the processing of sterol regulatory element-binding proteins (SREBPs) SREBF1/SREBP1 and SREBF2/SREBP2. INSIG1 binds to oxysterols, including 25-hydroxycholesterol, which modulates its interaction with SCAP and the retention of the SCAP-SREBP complex in the ER. In the presence of oxysterols, INSIG1 interacts with SCAP, retaining the SCAP-SREBP complex in the ER, thus preventing SCAP from escorting SREBF1/SREBP1 and SREBF2/SREBP2 to the Golgi apparatus. When sterol levels are low, or when INSIG1 is phosphorylated by PCK1, oxysterol binding is reduced, disrupting the interaction between INSIG1 and SCAP. This promotes Golgi transport of the SCAP-SREBP complex, followed by processing and nuclear translocation of SREBF1/SREBP1 and SREBF2/SREBP2. INSIG1 also regulates cholesterol synthesis by influencing the degradation of HMGCR. It initiates sterol-mediated ubiquitin-mediated ER-associated degradation (ERAD) of HMGCR by recruiting the reductase to the ubiquitin ligases AMFR/gp78 and/or RNF139. Furthermore, INSIG1 regulates the degradation of SOAT2/ACAT2 (acyl-CoA:cholesterol acyltransferase 2) when lipid levels are low. It initiates the ubiquitin-mediated degradation of SOAT2/ACAT2 by recruiting the ubiquitin ligases AMFR/gp78.
Gene References Into Functions
  1. INSIG1 variation may contribute to statin-induced changes in plasma triglycerides in a sex-specific manner. PMID: 26927283
  2. Studies suggest that precursor miR-122 molecules modulate polyadenylation site usage in Insig1 mRNAs, leading to down-regulation of Insig1 protein abundance. PMID: 28928276
  3. Research indicates that miR-92a may affect cholesterol metabolism by repressing insig1, resulting in elevated intracellular cholesterol levels, increased Golgi volume, and enhanced protein secretion. PMID: 28146316
  4. Findings have identified an interaction of three genes in the INSIG-SCAP-SREBP pathway on the risk of obesity, suggesting that these genes influence obesity through a complex interaction pattern rather than a single gene effect. PMID: 25028659
  5. Data demonstrate the essential role of PPARgamma (peroxisome proliferator-activated receptor gamma) and PPARgamma coactivator 1alpha (PGC-1alpha) in up-regulating Insig-1/2 expression. This defines a mechanistic pathway triggered by CD36, leading to cholesterol depletion in hepatocytes. PMID: 24371122
  6. Results suggest that the dysregulation of INSIG1 and SREBF1 caused by ART (assisted reproductive technologies) was observed not only in the fetus but also in the placenta, primarily in the ICSI (intracytoplasmic sperm injection) group. PMID: 24484994
  7. No significant associations were found between polymorphisms of the INSIG1 gene and metabolic syndrome. However, interactions between INSIG1 and INSIG2 were identified in significant 3-locus and 4-locus gene-gene interaction models. PMID: 20877301
  8. This study involved an observational analysis of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic/toxicogenomic. (HuGE Navigator) PMID: 20877301
  9. Genetic association studies have shown that SNPs (single nucleotide polymorphisms) in INSIG1, including the promoter region, influence hypertriglyceridemia. PMID: 19965593
  10. It is unlikely that common variation in INSIG1 has a major impact on the risk of type 2 diabetes in white Europeans. PMID: 20444954
  11. These data suggest that p97 recruits proteasomes to polytopic ER proteins, such as Insig-1, even before they are extracted from membranes. PMID: 19815544
  12. Reduced expression of INSIG1 and p41 Arp2/3 complex (p41-Arc) might be involved in gastric cancer development or progression. PMID: 12115587
  13. INSIG-1 plays a role in regulating cholesterol concentration in human cells. PMID: 12242342
  14. Data indicate that Insig-1 appears to play a critical role in the sterol-mediated trafficking of two proteins with sterol-sensing domains, HMG CoA reductase and SCAP. PMID: 12535518
  15. Insig-1 expression restricts lipogenesis in mature adipocytes and blocks differentiation in preadipocytes. PMID: 12869692
  16. Data suggest that short segments at the N and C termini of insulin-induced gene 1 (Insig-1) face the cytosol with most of the protein buried within the membrane, forming six transmembrane segments. PMID: 14660594
  17. nSREBPs (nuclear sterol regulatory element-binding proteins) are essential for high levels of lipid synthesis in the liver. Studies indicate that Insigs modulate nSREBP levels by binding and retaining SCAP in the ER. PMID: 15085196
  18. Insig-1 plays a role in feedback control of lipid synthesis in cultured cells. PMID: 15247248
  19. Insig-1 has a role in the activation of sterol regulatory element-binding protein induced by cellular stress. PMID: 15304479
  20. Insig is required for sterol-mediated inhibition of Scap/SREBP binding to COPII proteins in vitro. PMID: 15899885
  21. Research has identified gp78 as the E3 ubiquitin ligase that initiates sterol-accelerated degradation of reductase, and Insig-1 as a bridge between gp78/VCP (valosin-containing protein) and the reductase substrate. PMID: 16168377
  22. Under conditions of mild steroid depletion, the failure to ubiquitinate Insig-1 causes a delay in the release of the Scap/sterol regulatory element binding protein-2, but it does not abolish it. PMID: 16399501
  23. The degradation of ubiquitinated Insigs is controlled by serine residues flanking the sites of ubiquitination. PMID: 16549805
  24. These studies identify an aspartic acid residue that is crucial for the function of Insig1 and Insig2 proteins in regulating cholesterol homeostasis in mammalian cells. PMID: 16606821
  25. Insig-1 sterol-regulated degradation is mediated by the membrane-bound ubiquitin ligase gp78. PMID: 17043353
  26. Population studies demonstrate that INSIG1 plays a role in glucose homeostasis. PMID: 17106696
  27. Activation of CAR (constitutive androstane receptor) and PXR (pregnane X receptor) in mouse liver results in the activation of Insig-1 along with reduced protein levels of the active form of sterol regulatory element binding protein 1 (Srebp-1). PMID: 18187584
  28. Unsaturated fatty acid-mediated stabilization of Insig-1 enhances the ability of sterols to inhibit the proteolytic activation of SREBP-1, which activates transcription of genes involved in fatty acid synthesis. PMID: 18835813
  29. The INSIG1 gene, not the INSIG2 gene, has been associated with coronary heart disease: tagSNPs and haplotype-based association study. PMID: 18989534
  30. Studies have defined Insig-1 and Insig-2 as the minimal requirement for sterol-accelerated degradation of the membrane domain of reductase. PMID: 19638338
  31. Observational study of gene-disease association and pharmacogenomic/toxicogenomic. (HuGE Navigator) PMID: 18195716

Show More

Hide All

Database Links

HGNC: 6083

OMIM: 602055

KEGG: hsa:3638

STRING: 9606.ENSP00000344741

UniGene: Hs.520819

Protein Families
INSIG family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in all tissues tested with highest expression in the liver.

Q&A

What is the functional role of INSIG1 in sterol regulatory pathways?

INSIG1 serves as a crucial regulatory element in sterol metabolism through two primary mechanisms. First, it binds to sterol regulatory element-binding protein cleavage-activating protein (SCAP) in the endoplasmic reticulum, effectively preventing the proteolytic processing required for sterol regulatory element-binding protein (SREBP) activation . This interaction prevents SREBP from being transported to the Golgi for processing into its active transcription factor form, thus blocking SREBP-mediated gene transcription . Second, INSIG1 mediates the sterol-accelerated proteolytic degradation of HMG-CoA reductase (HMGCR), directly impacting the mevalonate pathway . This dual function establishes INSIG1 as a central negative feedback regulator that acts as a "brake" on lipogenic pathways in various tissues, particularly in adipocytes and hepatocytes .

Methodologically, researchers investigating these pathways typically employ cell culture models with INSIG1 overexpression or knockdown, followed by western blot analysis to track changes in SREBP processing and target gene expression. Transcriptome analysis after INSIG1 manipulation provides comprehensive insights into its regulatory networks.

How does INSIG1 expression change during metabolic disease progression?

INSIG1 exhibits dynamic expression patterns that correlate with metabolic disease states. In normal mice developing diet-induced obesity, INSIG1 mRNA increases progressively in adipose tissue as obesity develops and declines during dietary restriction . This pattern suggests INSIG1 responds to nutritional status and may serve as a compensatory mechanism to limit excessive lipogenesis during caloric excess.

In cell culture models, INSIG1 and INSIG2 expression rises in parallel with adipocyte protein 2 (aP2) mRNA during the differentiation of 3T3-L1 preadipocytes . Notably, carbohydrate response element-binding protein (ChREBP) mRNA, a lipogenic transcription factor, becomes detectable only during differentiation and specifically in high glucose (25 mM) conditions but not in low glucose (5 mM) environments .

Researchers commonly track these expression changes using quantitative PCR for mRNA levels and western blot analysis for protein levels across different metabolic conditions and disease stages.

What experimental models are most effective for studying INSIG1 function?

Several experimental systems have proven valuable for investigating INSIG1 biology:

Model SystemApplicationsKey MeasurementsAdvantages
293T cellsProtein overexpression, virus productionWestern blot, viral titersEasy transfection, high protein yields
Jurkat cellsHIV-1 research, immune cell contextVirus production assaysPhysiological T-cell environment
3T3-L1 cellsAdipocyte differentiationOil Red O staining, adipogenic marker expressionWell-characterized differentiation model
CRISPR/Cas9 knockout cell linesLoss-of-function studiesProtein expression, pathway activityClean genetic background
Mouse modelsIn vivo metabolic studiesTissue histology, metabolic parametersPhysiological relevance

When studying INSIG1 function in adipocyte differentiation, researchers frequently employ transfection of mouse or human INSIG1 into 3T3-L1 preadipocytes followed by Oil Red O staining to assess lipid accumulation and western blot analysis to measure adipogenic markers (aP2, PPARγ2) . For INSIG1 function in virus production, pseudovirus production assays with protein overexpression or gene knockouts in 293T cells provide valuable insights .

How does INSIG1 coordinate with different E3 ubiquitin ligases to regulate protein degradation pathways?

This substrate-specific coordination suggests INSIG1 may serve as an adaptor protein that recruits different E3 ligases based on the cellular context and targeted substrate. Research methods to investigate these interactions include:

  • Co-immunoprecipitation assays to confirm physical interactions between INSIG1 and specific E3 ligases

  • Ubiquitination assays using inhibitors specific to proteasomal or lysosomal degradation pathways

  • Microscopy to track intracellular localization of INSIG1, target proteins, and degradation machinery components at membrane sites such as the endoplasmic reticulum and endosomes

These methodological approaches have revealed that INSIG1 functions as a sentinel responsive to HIV-1 production, inhibiting HIV-1 replication specifically by accelerating the degradation of Gag protein .

What are the metabolic consequences of INSIG1 deficiency in different tissues during disease progression?

INSIG1 deficiency produces tissue-specific and context-dependent effects that reveal its complex role in metabolic homeostasis. In liver tissue, INSIG1 knockout (KO) mice show a fascinating metabolic paradox: despite increased SREBP activity and hepatic lipid deposition, they display protection from non-alcoholic steatohepatitis (NASH) when fed a NASH-inducing diet .

This protection stems from multiple mechanisms:

  • Enhanced desaturase activity and lipid remodeling that prevents hepatic lipotoxicity

  • Decreased liver infiltration of inflammatory cells (CD3+ T cells and CD45R+ B cells)

  • Reduced extracellular matrix deposition

  • Suppression of pathways involved in ER stress (e.g., Ddit3), oxidative damage, and apoptosis (e.g., Bax and Fasl)

Interestingly, INSIG1 KO mice are smaller/shorter than their wild-type littermates but do not show differences in fat mass, liver weight to body weight ratio, or markers of systemic and peripheral insulin resistance .

The research methodologies for investigating these phenotypes include:

  • Immunohistochemistry to assess inflammatory cell infiltration

  • Picrosirius red staining to evaluate extracellular matrix deposition

  • Transcriptome analysis with Ingenuity Pathway Analysis (IPA) to identify affected molecular pathways

  • Metabolic profiling to measure glucose, triglycerides, cholesterol, and free fatty acids

These findings suggest that targeted manipulation of INSIG1 activity could potentially provide therapeutic benefits in specific metabolic disease contexts.

How can researchers effectively measure and interpret INSIG1-mediated effects on SREBP processing in different experimental systems?

Measuring INSIG1-mediated effects on SREBP processing requires careful experimental design and interpretation due to the multi-step nature of SREBP activation. Researchers should implement a comprehensive strategy:

  • Protein processing analysis: Western blot analysis should track both precursor (inactive) and cleaved (nuclear, active) forms of SREBP1 and SREBP2 to assess processing efficiency. When INSIG1 is overexpressed, researchers can observe decreased levels of cleaved SREBP forms .

  • Target gene expression: qRT-PCR to measure mRNA levels of SREBP target genes (e.g., fatty acid synthase, HMG-CoA synthase) provides functional readouts of SREBP transcriptional activity.

  • Subcellular fractionation: Separating nuclear and cytoplasmic/membrane fractions allows direct measurement of SREBP nuclear translocation.

  • Confocal microscopy: Immunofluorescence staining of SREBP to visualize its subcellular localization provides spatial information about processing status.

  • Control for sterol levels: Since sterol levels affect INSIG1-SCAP interactions, researchers must carefully control or measure cellular sterol content to avoid confounding results. Importantly, during HIV-1 production, the cholesterol content of cells does not change significantly, suggesting INSIG1 can regulate protein degradation through cholesterol-independent mechanisms .

  • Time-course experiments: SREBP processing dynamics change over time, particularly after stimuli like insulin treatment or viral infection, necessitating temporal analysis.

When comparing data across different experimental systems, researchers should consider cell type-specific differences in the INSIG1-SREBP regulatory axis. For instance, adipocytes and hepatocytes may exhibit different baseline INSIG1 expression levels and responsiveness to metabolic stimuli.

What is the role of INSIG1 in viral infection and how does it differ from its metabolic functions?

INSIG1 plays a surprising role in viral infection that appears mechanistically distinct from its metabolic functions. During HIV-1 infection, INSIG1 is upregulated specifically during virus production but not during the infection process, suggesting it functions inside cells rather than at the plasma membrane .

Key findings about INSIG1's antiviral activity include:

  • Inhibition mechanism: INSIG1 inhibits HIV-1 production by accelerating the degradation of HIV-1 Gag protein, a critical structural component required for viral assembly .

  • Degradation pathway: Unlike INSIG1-mediated HMGCR degradation (which occurs via AMFR and the proteasome), INSIG1 promotes Gag degradation by coordinating with TRC8 E3 ligase through the lysosome pathway .

  • Experimental evidence:

    • Overexpression of INSIG1 significantly inhibits HIV-1 production in both 293T and Jurkat cells for both Env and VSV-G enveloped pseudoviruses

    • INSIG1 overexpression reduces cellular levels of Pr55 Gag protein but does not affect viral glycoproteins (Env and VSV-G)

    • Knockout of INSIG1 using CRISPR/Cas9 increases HIV-1 production and is associated with Gag protein accumulation

    • Reintroducing INSIG1 with a native promoter in knockout cells restores HIV-1 production to wild-type levels

This antiviral function represents a cholesterol-independent role for INSIG1 through the INSIG1-TRC8 E3 ligase system, highlighting its multifunctionality beyond metabolic regulation. Researchers studying these distinct functions should carefully consider the cellular context and implement appropriate controls for each pathway.

How do genetic variants of INSIG1 affect its function in experimental models and clinical contexts?

While the search results don't specifically address INSIG1 genetic variants, researchers interested in this area should consider the following methodological approaches:

  • Functional characterization of variants: Recombinant expression of INSIG1 variants in appropriate cell models (hepatocytes, adipocytes) followed by assessment of:

    • Binding affinity to key partners (SCAP, TRC8, AMFR)

    • Protein stability and half-life measurements

    • Subcellular localization

    • Effect on SREBP processing and target gene expression

  • Disease association studies: Analysis of INSIG1 variants in cohorts with metabolic disorders (obesity, NAFLD/NASH, dyslipidemia) or relevant viral infections to identify potential associations with disease susceptibility or progression.

  • Animal models: Generation of knock-in mice expressing specific INSIG1 variants to assess phenotypic consequences in vivo, particularly in response to high-fat diet challenges or viral infections.

  • Structure-function analysis: Understanding how specific variants affect protein structure and interaction domains. This may require crystallography or modeling approaches since the three-dimensional structure of INSIG1 has been challenging to resolve due to its multiple transmembrane domains.

  • Expression quantitative trait loci (eQTL) analysis: Evaluation of how variants affect INSIG1 expression levels in different tissues and conditions.

When conducting such studies, researchers should carefully document the specific variant nomenclature according to standard guidelines and consider both common and rare variants in their analysis.

What are the most effective approaches for generating and validating INSIG1 knockout models?

Creating reliable INSIG1 knockout models requires careful consideration of the experimental system and validation approach:

  • CRISPR/Cas9 gene editing: The most common contemporary approach for generating INSIG1 knockout cell lines, as demonstrated in the literature where CRISPR/Cas9 was used to create INSIG1 knockout 293T cells . Key considerations include:

    • Guide RNA design targeting early exons to ensure complete protein disruption

    • Screening multiple clones to identify complete knockouts

    • Sequencing validation of the targeted region

  • Validation strategies: Comprehensive validation of INSIG1 knockout models should include:

    • Western blot analysis to confirm absence of INSIG1 protein

    • qRT-PCR to verify reduction in INSIG1 mRNA

    • Functional assays showing expected downstream effects (increased SREBP processing, enhanced HIV-1 production)

    • Rescue experiments by reintroducing INSIG1 with native promoter and synonymous encoding sequence to restore wild-type phenotype

  • Control for compensation: Potential compensatory upregulation of INSIG2 should be assessed, as these proteins have partially overlapping functions. Researchers should measure INSIG2 levels in INSIG1 knockout models.

  • Tissue-specific approaches: For in vivo studies, conditional knockout strategies using Cre-loxP systems targeting specific tissues (liver, adipose) may be preferable to global knockouts, which could have developmental consequences.

The phenotypic analysis of INSIG1 knockout models should include assessment of relevant pathways through both targeted and unbiased approaches, such as transcriptome analysis, to identify affected molecular networks and unexpected compensatory mechanisms .

What technical considerations are important when measuring INSIG1 protein interactions and degradation pathways?

Investigating INSIG1 protein interactions and degradation pathways presents several technical challenges that researchers should address:

  • Membrane protein considerations: As INSIG1 is a membrane-bound protein with multiple transmembrane domains, standard interaction assays may require modification:

    • Use of mild detergents for extraction that maintain protein-protein interactions

    • Split-ubiquitin or membrane yeast two-hybrid systems for interaction screening

    • Proximity labeling approaches (BioID, APEX) to identify interactions in native cellular environments

  • Degradation pathway determination: When studying INSIG1-mediated protein degradation, researchers should distinguish between proteasomal and lysosomal pathways:

    • Use specific inhibitors: MG132 for proteasome, chloroquine or bafilomycin A1 for lysosome

    • Monitor ubiquitination patterns (K48 linkage suggests proteasomal degradation, while K63 may indicate lysosomal targeting)

    • Track protein half-life in the presence of different inhibitors

  • Co-localization analysis: Since INSIG1 functions at intracellular membrane sites such as the endoplasmic reticulum and endosomes, co-localization studies with compartment markers are essential :

    • Confocal microscopy with appropriate markers for ER, Golgi, and endosomes

    • Super-resolution microscopy for detailed spatial relationships

    • Live-cell imaging to track dynamic interactions

  • Specificity controls: When studying E3 ligase interactions (AMFR, TRC8), researchers should:

    • Use inactive E3 ligase mutants as negative controls

    • Perform siRNA/shRNA knockdown of specific E3 ligases to confirm pathway specificity

    • Include immunoprecipitation controls to exclude non-specific binding

  • Sterol dependence assessment: Since INSIG1 function can be sterol-dependent or independent, researchers should:

    • Control cellular sterol content using lipoprotein-depleted media

    • Use sterol depletion/repletion experiments to differentiate sterol-dependent and independent functions

    • Measure cellular cholesterol content alongside functional assays to correlate with observed effects

These technical considerations ensure accurate characterization of INSIG1's diverse functions in protein degradation pathways.

How might INSIG1-targeted therapeutics be developed for metabolic diseases or viral infections?

The multifunctional nature of INSIG1 presents intriguing therapeutic possibilities for both metabolic diseases and viral infections, though with important considerations:

For metabolic disease applications:

  • INSIG1 activation could theoretically reduce excessive lipogenesis in conditions like NAFLD by enhancing its "brake" function on SREBP processing .

  • Paradoxically, INSIG1 inhibition might be beneficial in some contexts, as INSIG1 knockout mice show protection from NASH through enhanced lipid remodeling and reduced inflammation despite increased hepatic lipid content .

For antiviral applications:

  • Enhancing INSIG1 expression or activity could potentially boost its HIV-1 inhibitory effects by accelerating Gag protein degradation .

  • Interventions targeting the INSIG1-TRC8 interaction specifically might enhance viral protein degradation without affecting metabolic pathways.

Development approaches should include:

  • Structure-based drug design: Though challenging due to INSIG1's transmembrane nature, focusing on specific protein-protein interaction domains.

  • Pathway modulators: Compounds that indirectly enhance INSIG1 expression or activity through upstream regulatory pathways.

  • Tissue-specific delivery: Technologies that target liver or immune cells specifically to minimize off-target effects.

  • Screening strategies: High-throughput assays measuring INSIG1-mediated protein degradation, SREBP processing, or viral production.

Researchers must carefully consider potential side effects given INSIG1's role in fundamental metabolic processes and design therapeutic strategies that modulate specific INSIG1 functions while minimizing disruption to other pathways.

How does INSIG1 function change in different cell types and what are the implications for tissue-specific research?

INSIG1 exhibits notable cell type-specific functions that researchers must consider when designing and interpreting experiments:

In adipocytes:

  • INSIG1 expression rises during differentiation of preadipocytes, paralleling aP2 mRNA .

  • Overexpression completely prevents differentiation and lipid accumulation in 3T3-L1 preadipocytes .

  • INSIG1 blocks upregulation of adipogenic transcription factors PPARγ2 and ChREBP while reducing downregulation of preadipocyte factor 1 .

In hepatocytes:

  • INSIG1 deficiency leads to increased lipid deposition but paradoxically protects from NASH through enhanced lipid remodeling and reduced inflammation .

  • INSIG1 knockout mice show decreased liver infiltration of lymphocytes and reduced ECM deposition despite the model being only mildly NASH-inducing .

In immune cells:

  • INSIG1 is upregulated during HIV-1 production in T-cell lines .

  • INSIG1 coordinates with TRC8 to promote lysosomal degradation of viral Gag protein .

These tissue-specific functions suggest several methodological implications:

Understanding these tissue-specific differences is critical for translating basic INSIG1 research into targeted therapeutic approaches for metabolic diseases or viral infections.

What is known about the evolutionary conservation of INSIG1 and how can comparative biology inform human INSIG1 research?

Though not explicitly covered in the search results, evolutionary conservation analysis of INSIG1 represents an important research direction that can provide insights into functional domains and species-specific adaptations. Researchers investigating this area should consider:

  • Sequence conservation analysis: Comparing INSIG1 sequences across species to identify highly conserved regions likely representing functional domains critical for:

    • SCAP binding and SREBP regulation

    • E3 ligase interactions (AMFR, TRC8)

    • Transmembrane topology and ER localization

  • Functional conservation testing: Experimental approaches to determine whether INSIG1 from different species can complement human INSIG1 functions:

    • Cross-species rescue experiments in knockout models

    • Chimeric protein studies to map functional domains

    • Heterologous expression systems to test conservation of interaction partners

  • Adaptive evolution analysis: Identifying regions under positive selection that might reflect species-specific adaptations related to:

    • Metabolic adaptations to different diets

    • Resistance to pathogens (especially for antiviral functions)

    • Tissue-specific expression patterns

  • Model organism selection: Choosing appropriate model organisms for studying specific INSIG1 functions based on:

    • Conservation of regulatory pathways

    • Similarity of metabolic physiology

    • Susceptibility to relevant pathogens

Comparative biology approaches can help researchers prioritize functional domains for detailed study and may identify novel INSIG1 functions that have evolved in specific lineages, potentially revealing new therapeutic targets or experimental approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.