Recombinant Human Insulin-induced gene 2 protein (INSIG2)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Human INSIG2 is a synthetically produced, full-length human protein (amino acids 1–225) expressed in a cell-free system, achieving ≥85% purity for experimental use . It replicates the native protein's function as an endoplasmic reticulum (ER)-resident oxysterol-binding protein that:

  • Inhibits cholesterol biosynthesis by retaining the SCAP-SREBP complex in the ER, preventing activation of sterol regulatory element-binding proteins (SREBPs) .

  • Triggers sterol-dependent ubiquitination and degradation of HMG-CoA reductase (HMGCR), the rate-limiting enzyme in cholesterol synthesis .

Mechanism of Action

INSIG2 operates through two primary pathways:

  1. SCAP-SREBP Retention: Binds oxysterols (e.g., 25-hydroxycholesterol) to stabilize interactions with SCAP, blocking Golgi transport of SREBPs .

  2. HMGCR Degradation: Recruits E3 ubiquitin ligase RNF139 to mediate ER-associated degradation (ERAD) of HMGCR under high sterol conditions .

Metabolic Regulation

  • CREBH-Insig-2a Signaling: Glucagon activates CREBH, upregulating the liver-specific Insig-2a isoform to suppress SREBP-1c and reduce hepatic lipogenesis .

    • Key Data: siRNA knockdown of Insig-2 increased triglycerides by 40% in hepatocytes .

Genetic Associations

  • Obesity Link: The INSIG2 SNP rs7566605 (CC genotype) is associated with severe obesity in Japanese populations (OR = 1.61, P = 0.0003) .

Comparative Analysis: INSIG1 vs. INSIG2

FeatureINSIG1INSIG2
Sterol SensitivityHigher affinity for SCAP Requires sterols for SCAP binding
Expression RegulationSREBP-dependent CREBH- and cAMP-dependent
Tissue DistributionUbiquitous Liver-enriched (Insig-2a isoform)

Research Applications

  • Drug Discovery: Target for dyslipidemia therapies due to its role in suppressing lipogenic genes .

  • Gene Expression Studies: Used to investigate INSIG2 promoter regulation by SAP1a and insulin signaling .

  • Structural Biology: Purified recombinant protein enables crystallography studies of sterol-binding domains .

Product Specs

Buffer
For liquid delivery forms, the default storage buffer is a Tris/PBS-based buffer containing 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer used prior to lyophilization is a Tris/PBS-based buffer containing 6% Trehalose.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format currently in stock. However, if you have any specific requirements for the delivery form, please indicate your preference when placing the order, and we will prepare the protein accordingly.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the protein at -20°C/-80°C. Our default final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life of the protein is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Synonyms
INSIG2; Insulin-induced gene 2 protein; INSIG-2
Datasheet & Coa
Please contact us to get it.
Expression Region
1-225aa
Mol. Weight
32.2 kDa
Protein Length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
metabolism
Source
in vitro E.coli expression system
Species
Homo sapiens (Human)
Target Names
INSIG2
Target Protein Sequence
MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPPDVIASIFSSAWWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNIQLSLTLAALSIGLWWTFDRSRSGFGLGVGIAFLATVVTQLLVYNGVYQYTSPDFLYVRSWLPCIFFAGGITMGNIGRQLAMYECKVIAEKSHQE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
INSIG2 is an oxysterol-binding protein that plays a crucial role in the feedback regulation of cholesterol synthesis. It achieves this by controlling both the endoplasmic reticulum (ER) to Golgi transport of SCAP and the degradation of HMGCR.

Acting as a negative regulator of cholesterol biosynthesis, INSIG2 mediates the retention of the SCAP-SREBP complex within the ER, thereby inhibiting the processing of sterol regulatory element-binding proteins (SREBPs) SREBF1/SREBP1 and SREBF2/SREBP2.

INSIG2 binds to oxysterols, including 22-hydroxycholesterol, 24-hydroxycholesterol, 25-hydroxycholesterol, and 27-hydroxycholesterol, which in turn modulates its interaction with SCAP and the retention of the SCAP-SREBP complex in the ER. In the presence of oxysterols, INSIG2 interacts with SCAP, effectively retaining the SCAP-SREBP complex in the ER, preventing SCAP from escorting SREBF1/SREBP1 and SREBF2/SREBP2 to the Golgi apparatus.

Sterol deprivation or phosphorylation by PCK1 reduces oxysterol-binding, disrupting the interaction between INSIG2 and SCAP. This promotes Golgi transport of the SCAP-SREBP complex, leading to the processing and subsequent nuclear translocation of SREBF1/SREBP1 and SREBF2/SREBP2. Additionally, INSIG2 regulates cholesterol synthesis by influencing the degradation of HMGCR. It initiates the sterol-mediated ubiquitin-mediated ER-associated degradation (ERAD) of HMGCR by recruiting the reductase to the ubiquitin ligase RNF139.
Gene References Into Functions
  1. INSIG2 gene single nucleotide polymorphisms and global DNA methylation are linked with weight loss in obese patients. PMID: 29138870
  2. INSIG2 plays a role in weight gain and obesity during clozapine treatment PMID: 27885961
  3. These results indicate that HIF-mediated induction of Insig-2 and degradation of HMGCR are physiologically relevant events that guard against wasteful oxygen consumption and inappropriate cell growth during hypoxia. PMID: 28416613
  4. There may be a connection between INSIG2 expression and metastatic dissemination of colorectal cancer without any effect on tumorigenesis. PMID: 26662938
  5. Insulin resistance in obese boys leads to up-regulation of INSIG2 gene expression as well as to down-regulation of PFKFB1, PFKFB3, and HK2 genes in the blood cells as compared to obese patients with normal insulin sensitivity. PMID: 26827442
  6. Results confirmed that genetic variation in INSIG2 is associated with both overweight and LDL in non-Hispanic white children. PMID: 25607990
  7. This study suggests that the G allele in the INSIG2 single nucleotide polymorphism rs7566605 is more relevant for changes in intramuscular adipose tissue following training than for the amount of subcutaneous fat. PMID: 23941145
  8. INSIG2 is involved in adipogenesis and MC4R effects hormonal appetite control in response to the amount of adipose tissue. PMID: 24518831
  9. The results provided evidence for identifying genetic factors of nonalcoholic fatty liver disease (NAFLD) and may be useful for risk assessment and personalized medicine of NAFLD. PMID: 24458218
  10. The INSIG2 rs7566605 SNP may not play a role in the development of obesity-related metabolic traits in Malaysian Malays. PMID: 25062423
  11. Data show the essential role of PPARgamma and PPARgamma coactivator 1alpha (PGC-1alpha) in up-regulating Insig-1/2 expression, defining a mechanistic pathway triggered by CD36, and leading to cholesterol depletion in hepatocytes. PMID: 24371122
  12. The rs13428113 polymorphism in INSIG2 gene was associated with abnormal lipid metabolism in overweight and obese children. PMID: 21163096
  13. genetic association/nutrigenomics studies of populations in Samoa: Data suggest that an SNP in INSIG2 (rs9308762) is associated with increased risk of metabolic syndrome X in Samoans eating modern diet (rather than traditional Samoan diet). PMID: 22968099
  14. In single-marker-based analysis, the INSIG2 rs11123469-C homozygous genotype was found to be more frequent in patients with metabolic syndrome than those without metabolic syndrome. PMID: 20877301
  15. Single nucleotide polymorphism in INSIG2 is associated with asthma susceptibility through gene-gene interactions. PMID: 22355322
  16. Results indicated that the G-102A INSIG2 polymorphism has no consistent effect on BMI in general populations, but could influence HDL cholesterol in females. PMID: 21978759
  17. INSIG2 was significantly associated with fasting plasma glucose in patients with schizophrenia PMID: 22020349
  18. No significant associations were observed between rs7566605 near the INSIG2 gene and any adiposity-related phenotypes in African- and European-American youth. PMID: 21544599
  19. Insig2 is overexpressed in pancreatic cancer under hypoxic conditions and is correlated with the malignant behaviors of pancreatic cancer. Insig2 knockdown decreased the cell proliferation and invasion of human pancreatic cancer cell line SUIT-2. PMID: 21443541
  20. genetic polymorphism along with sex and age factors contribute to prevalence of cardiovascular disease PMID: 20920244
  21. the INSIG2 rs7566605 polymorphism is not associated with body mass index and breast cancer risk PMID: 20955599
  22. These results suggest that INSIG2 genetic variants may have a more direct role in lipid and apolipoprotein B/lipoprotein metabolism than in obesity. PMID: 20858904
  23. This study was unable to replicate significant associations in patients of European ancestry and weight-gain induced by antipsychotics with single-nucleotide polymorphisms in Insulin Induced Gene 2. PMID: 20373477
  24. Results indicated that this INSIG2 polymorphism has no significant effect on body mass index and plasma lipids in the Czech Slavonic population. PMID: 20653998
  25. While study did not confirm an association between rs7566605 and BMI in obese children in Sardinia, abnormalities of glucose metabolism and genotype, indicate that INSIG2 may be involved in glucose metabolism. PMID: 20645959
  26. a role of INSIG2 sequence variation in the regulation of cholesterol metabolism. PMID: 20045156
  27. Deletion analyses on 3 kb of 5'-flanking DNA of the INSIG2 gene revealed the functional importance of a 350-bp region upstream of the transcription start site. PMID: 20145255
  28. this study suggests that sequence variants in INSIG2 likely influence the risk for obesity related traits PMID: 20028541
  29. A total of 15.1% of participants were overweight or obese at age 16 y. No associations with INSIG2 were found. PMID: 20007308
  30. children with the combination of the INSIG2 CC genotype and the FTO AA genotype showed the worst outcome in a lifestyle intervention, suggesting that the effects of INSIG2 and FTO aggravate each other. PMID: 19224890
  31. degradation of ubiquitinated Insigs is controlled by serine residues flanking the sites of ubiquitination PMID: 16549805
  32. These studies identify a aspartic acid residue that is crucial for the function of Insig1 and Insig2 proteins in regulating cholesterol homeostasis in mammalian cells. PMID: 16606821
  33. INSIG-2 is a membrane bound oxysterol-binding protein with specificity for cholesterol derivatives that possess hydroxyl groups on the side chain. PMID: 17428920
  34. The association of a SNP upstream of INSIG2 with body mass index is not reproduced in all cohorts. PMID: 17465681
  35. The rs7566605 single-nucleotide polymorphism (SNP) was not related to plasma triglyceride levels. This suggests that, at the least, the true size of the effect on obesity of this SNP is likely to be considerably less than reported previously. PMID: 17471297
  36. the variant upstream of INSIG2 is not a determinant of BMI in Indian population. PMID: 17489846
  37. Children who were CC-homozygotes at SNP rs7566605 in the vicinity of INSIG2 lost less weight in this lifestyle intervention. PMID: 18003761
  38. There is no association of the rs7566605 variant with overweight in Japanese people. PMID: 18070740
  39. There is a lack of association between single-nucleotide polymorphism rs7566605 and being overweight among the Japanese (in the middle-aged and elderly population). PMID: 18223638
  40. results do not support an association of the INSIG2 gene with the regulation of body weight or parameters related to lipoprotein metabolism PMID: 18239574
  41. found no significant association of rs7566605 polymorphism with body mass index (BMI) and waist circumference among all participants (P=0.52), however in subjects from Shangai, the C/C genotype was associated with higher risk of BMI and obesity PMID: 18270535
  42. INSIG2 is involved in adipocyte metabolism and body weight regulation. PMID: 18319320
  43. Increased BMI in morbid obesity is associated with a combination of FTO and INSIG2 SNPs. PMID: 18347269
  44. Insig2 is a novel colon cancer biomarker, and suggest, for the first time, a reasonable connection between Insig2 and Bax-mediated apoptosis through the mitochondrial pathway. PMID: 18464289
  45. Polymorphism may be associated with obesity and body mass index in an Indian population. PMID: 18514965
  46. it is suggested that the CC genotype of the INSIG2 upstream SNP, rs7566605, is a protective genetic factor against hypercholesterolaemia, when exposed to a high-fat diet. PMID: 18570692
  47. rs7566605 in the upstream region of the INSIG2 gene was found to be associated with obesity, i.e., severe obesity, in Japanese. PMID: 18615239
  48. INSIG2 polymorphisms play no apparent role in the development of common forms of obesity in the Danish population but may influence body mass index and physical activity. PMID: 18682847
  49. common variants in FTO and INSIG2 are nominally associated with quantitative measures of obesity PMID: 18839134
  50. The INSIG1 gene, not the INSIG2 gene, associated with coronary heart disease: tagSNPs and haplotype-based association study. PMID: 18989534

Show More

Hide All

Database Links

HGNC: 20452

OMIM: 608660

KEGG: hsa:51141

STRING: 9606.ENSP00000245787

UniGene: Hs.7089

Protein Families
INSIG family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is INSIG2 and what is its main function?

INSIG2 (Insulin-induced gene 2) encodes an endoplasmic reticulum protein that plays a critical role in regulating cholesterol synthesis and fatty acid metabolism. It functions primarily as a negative regulator of cholesterol biosynthesis by mediating the retention of the SCAP-SREBP complex in the endoplasmic reticulum, thereby blocking the processing of sterol regulatory element-binding proteins (SREBPs) . This protein belongs to a family of oxysterol-binding proteins that interact with SCAP (SREBP cleavage-activating protein) and HMGCR (3-hydroxy-3-methylglutaryl-CoA reductase) to maintain cholesterol homeostasis in mammalian cells.

In the presence of oxysterols (oxidized derivatives of cholesterol), INSIG2 binds to SCAP, which prevents SCAP from escorting SREBPs to the Golgi apparatus for proteolytic activation. This regulatory mechanism effectively suppresses the transcription of genes involved in cholesterol and fatty acid synthesis under high sterol conditions .

How does INSIG2 differ between humans and rodents?

In rodents, two distinct INSIG2 transcripts have been identified: Insig2a and Insig2b. These two variants differ in their noncoding first exons that splice into a common second exon through the use of different promoters. While both transcripts encode identical proteins, they exhibit different regulation patterns, with Insig2a being down-regulated by insulin in rodent liver .

Interestingly, comparative analysis of human and rodent genomic sequences revealed that despite high sequence homology between the species, the INSIG2a transcript is not expressed in human liver. RT-PCR analysis confirmed that while both mRNA variants (Insig2a and Insig2b) were detected in mouse and rat liver, only the INSIG2b form was detected in human liver samples. This finding was further confirmed in human cell lines including HEK293T and HepG2, where no trace of the INSIG2a transcript was found .

What methodologies are recommended for studying INSIG2 expression?

For investigating INSIG2 expression in tissue or cell samples, the following methodological approaches are recommended:

  • RT-PCR Analysis: Design primers specific to INSIG2 variants for detection of transcript expression. For human samples, focus on the INSIG2b form as it is the predominant transcript in human liver and cell lines .

  • Promoter Activity Assays:

    • Clone the promoter region upstream of a reporter gene (e.g., luciferase)

    • Create serial 5′ truncations of the promoter to identify crucial regulatory regions

    • Transfect constructs into relevant cell lines (HEK293T or HepG2 have been successfully used)

    • Measure reporter activity to determine functional importance of specific regions

  • Site-Directed Mutagenesis: To analyze the contribution of individual binding sites within the INSIG2 promoter, introduce specific mutations and assess their impact on promoter activity through reporter assays .

  • ChIP Assay: Chromatin immunoprecipitation followed by real-time PCR can be used to verify the binding of transcription factors to the INSIG2 promoter region in vivo .

What is known about the regulation of human INSIG2 gene expression?

The human INSIG2 gene expression is regulated through several mechanisms:

  • Promoter Structure: Functional promoter analysis has revealed that a 350-bp region upstream of the transcription start site is sufficient to retain full promoter activity, with the first 150 bp still retaining 40% of the promoter activity in cell lines like HEK293T and HepG2 .

  • Transcription Factor Binding: The Ets family of transcription factors plays a crucial role in regulating INSIG2 expression. Particularly, site-directed mutagenesis studies have shown that mutation of Ets elements in the promoter leads to a dramatic drop in reporter activity, with the Ets-a site having the greatest effect .

  • Specific Transcription Factors: Electrophoretic mobility shift assays and ChIP analyses have demonstrated that ELK1 and SAP1a (serum response factor accessory protein-1a) transcription factors bind to the Ets-a element in the human INSIG2 promoter .

  • Insulin Regulation: Unlike in rodents where Insig2a is down-regulated by insulin, evidence suggests that insulin activates the human INSIG2 promoter through a process mediated by phosphorylated SAP1a .

What experimental approaches are recommended for analyzing INSIG2-SCAP interactions?

To study the interactions between INSIG2 and SCAP under various sterol conditions, researchers can employ several advanced methodologies:

  • Co-Immunoprecipitation (Co-IP) Assays: This technique can be used to pull down protein complexes and analyze the interaction between INSIG2 and SCAP under different sterol conditions.

    • Express tagged versions of INSIG2 and SCAP in appropriate cell systems

    • Treat cells with different sterols, including 22-hydroxycholesterol, 24-hydroxycholesterol, 25-hydroxycholesterol, and 27-hydroxycholesterol

    • Immunoprecipitate one protein and detect the presence of the interacting partner by western blotting

  • FRET (Förster Resonance Energy Transfer) Analysis: This technique allows for the measurement of protein-protein interactions in living cells.

    • Fuse INSIG2 and SCAP with appropriate fluorescent proteins

    • Monitor changes in FRET efficiency under different sterol conditions

    • Quantify interaction strength and dynamics in real-time

  • Bimolecular Fluorescence Complementation (BiFC): This approach can visualize the spatial and temporal dynamics of protein interactions.

    • Split a fluorescent protein and fuse each half to INSIG2 and SCAP

    • When the proteins interact, fluorescence is reconstituted

    • Analyze the subcellular localization of the interaction under various sterol conditions

How can recombinant human INSIG2 protein be optimally expressed and purified for structural studies?

For structural and functional studies, high-quality recombinant INSIG2 protein is essential. Based on available information, the following protocol is recommended:

  • Expression System Selection:

    • Cell-free expression systems have been successfully used to produce full-length human INSIG2 protein (amino acids 1-225)

    • Alternative systems include insect cells (Sf9, High Five) which are often suitable for membrane proteins

  • Construct Design:

    • Include appropriate tags for purification (e.g., His-tag, FLAG-tag)

    • Consider codon optimization for the expression system

    • For structural studies, construct design should account for potential flexible regions that might interfere with crystallization

  • Purification Strategy:

    • Use detergent screening to identify optimal solubilization conditions

    • Implement a multi-step purification approach:
      a. Affinity chromatography based on the chosen tag
      b. Size exclusion chromatography to separate aggregates
      c. Ion exchange chromatography for further purification if needed

  • Quality Assessment:

    • SDS-PAGE analysis to confirm purity (≥85% purity is typically achievable)

    • Western blotting for identity confirmation

    • Mass spectrometry for accurate molecular weight determination

    • Circular dichroism to assess secondary structure integrity

What are the challenges in investigating INSIG2's role in metabolic diseases?

Investigating INSIG2's role in metabolic diseases presents several significant challenges:

  • Genetic Complexity: Multiple genetic loci are linked to metabolic disorders, making it difficult to isolate INSIG2's specific contributions. Genome-wide linkage analyses have identified the locus where the INSIG2 gene is located as potentially linked to body mass index and obesity in humans .

  • Polymorphic Variation Analysis: While Herbert et al. identified a genetic variant associated with obesity in the genomic region where INSIG2 is located using data from Framingham Heart Study participants, comprehensive data on human polymorphic variation in INSIG2 remains limited .

  • Tissue-Specific Effects: INSIG2 may have different functions in different tissues. For instance, in type 2 diabetes and obesity, SREBP1c mRNA levels decrease in adipose tissue but are elevated in the liver of obese mice . This tissue specificity complicates the design of experiments and interpretation of results.

  • Methodological Approaches:

    • Animal Models: Develop and characterize appropriate knockout or transgenic models

    • Human Genetic Studies: Design case-control studies with sufficient statistical power

    • Tissue-Specific Analysis: Implement techniques to study INSIG2 function in specific tissues

    • Integration of Multiple Data Types: Combine genetic, transcriptomic, and proteomic data

How does phosphorylation affect INSIG2's function in regulating cholesterol synthesis?

Phosphorylation plays a crucial role in modulating INSIG2's function in the regulation of cholesterol synthesis:

  • Mechanism of Action: Phosphorylation of INSIG2 by PCK1 (phosphoenolpyruvate carboxykinase 1) reduces its oxysterol-binding capacity. This disrupts the interaction between INSIG2 and SCAP, promoting Golgi transport of the SCAP-SREBP complex .

  • Regulatory Consequences: The phosphorylation-induced disruption of INSIG2-SCAP interaction leads to:

    • Processing of SREBPs in the Golgi apparatus

    • Nuclear translocation of processed SREBPs

    • Activation of genes involved in cholesterol and fatty acid synthesis

  • Experimental Approach to Study Phosphorylation:

    • Phospho-specific antibodies can be used to detect phosphorylated INSIG2

    • Phosphomimetic mutations (e.g., serine to aspartate) can simulate constitutive phosphorylation

    • Phospho-dead mutations (e.g., serine to alanine) can prevent phosphorylation

    • Mass spectrometry can identify specific phosphorylation sites

  • Physiological Context: Understanding how hormonal and nutritional signals regulate INSIG2 phosphorylation can provide insights into metabolic disorders associated with dysregulated cholesterol metabolism.

What are the latest findings regarding INSIG2 promoter regulation?

Recent research has uncovered several key aspects of INSIG2 promoter regulation:

  • Ets Family Transcription Factors: The Ets family of transcription factors plays a critical role in regulating human INSIG2 expression. Specifically, SAP1a (serum response factor accessory protein-1a) has been shown to interact with the Ets-a element in the INSIG2 promoter .

  • Promoter Functional Elements: Deletion analyses on 3 kb of 5′-flanking DNA of the human INSIG2 gene have revealed the functional importance of a 350-bp region upstream of the transcription start site. Within this region, a 150-bp fragment still retains 40% of the promoter activity, suggesting it contains a basal promoter region critical for INSIG2 gene expression .

  • Insulin Regulation: Unlike in rodents where Insig2a is down-regulated by insulin, evidence suggests that insulin activates the human INSIG2 promoter through a process mediated by phosphorylated SAP1a. This represents an unexpected mode of regulation for INSIG2 expression in human liver .

  • Experimental Techniques for Studying Promoter Regulation:

    • Reporter Assays: Using luciferase constructs with various promoter fragments

    • Chromatin Immunoprecipitation (ChIP): To verify transcription factor binding in vivo

    • Electrophoretic Mobility Shift Assays (EMSA): To analyze protein-DNA interactions in vitro

    • Site-Directed Mutagenesis: To determine the functional importance of specific binding sites

What CRISPR-Cas9 strategies are most effective for studying INSIG2 function?

CRISPR-Cas9 technology offers powerful approaches for investigating INSIG2 function in cellular systems:

  • Knockout Strategies:

    • Design guide RNAs targeting early exons of INSIG2

    • Verify knockout efficiency by Western blotting and RT-PCR

    • Analyze phenotypic changes in cholesterol metabolism and SREBP processing

    • Consider potential compensatory mechanisms (e.g., upregulation of INSIG1)

  • Knock-in Approaches:

    • Generate tagged versions of INSIG2 at endogenous loci for tracking protein localization

    • Introduce specific mutations to study structure-function relationships

    • Create reporter constructs to monitor INSIG2 expression in real-time

  • CRISPRi/CRISPRa Systems:

    • Use CRISPR interference (CRISPRi) for targeted repression of INSIG2 expression

    • Apply CRISPR activation (CRISPRa) to enhance INSIG2 expression

    • These approaches allow for temporal control of gene expression without permanent genomic modifications

  • Screening Applications:

    • Develop CRISPR screens to identify genes that interact with INSIG2

    • Design phenotypic assays based on cholesterol metabolism or SREBP processing

    • Use pooled or arrayed screening formats depending on the research question

How can contradictions in INSIG2 research data be effectively analyzed and reconciled?

When confronted with contradictory data in INSIG2 research, systematic approaches to analysis and reconciliation are essential:

  • Methodological Variations:

    • Compare experimental methodologies in detail

    • Assess differences in cell types, culture conditions, and analytical techniques

    • Consider the sensitivity and specificity of detection methods

  • Species-Specific Differences:

    • Recognize that INSIG2 regulation differs between humans and rodents

    • In rodents, two distinct transcripts (Insig2a and Insig2b) are expressed, while only INSIG2b is detected in human liver

    • These differences may explain some contradictions in research findings

  • Tissue-Specific Effects:

    • INSIG2 function may vary across different tissues

    • In metabolic disorders, SREBP1c levels decrease in adipose tissue but increase in liver

    • Design experiments to specifically address tissue-specific mechanisms

  • Statistical Analysis and Replication:

    • Apply robust statistical methods to evaluate significance

    • Consider statistical power in experimental design

    • Implement independent replication studies when contradictions arise

What quality control measures are crucial when working with recombinant INSIG2 protein?

Ensuring the quality of recombinant INSIG2 protein is essential for reliable experimental outcomes:

  • Purity Assessment:

    • SDS-PAGE analysis should confirm purity of at least 85%

    • Silver staining for detecting low-level contaminants

    • Mass spectrometry for comprehensive purity analysis

  • Functional Validation:

    • Binding assays with known interacting partners (SCAP, oxysterols)

    • Verification of oxysterol binding capacity with various sterols including 22-hydroxycholesterol, 24-hydroxycholesterol, 25-hydroxycholesterol, and 27-hydroxycholesterol

    • Confirmation of ability to mediate SCAP-SREBP retention in the endoplasmic reticulum

  • Structural Integrity:

    • Circular dichroism spectroscopy to verify secondary structure

    • Thermal shift assays to assess protein stability

    • Size exclusion chromatography to detect aggregation

  • Storage Stability:

    • Optimize buffer conditions to maintain protein stability

    • Determine appropriate storage temperature and freeze-thaw tolerance

    • Implement regular quality checks for long-term stored protein samples

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.