Recombinant Human Interferon-induced transmembrane protein 1 (IFITM1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments default to blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted per your needs.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during production. If a specific tag is required, please inform us in advance, and we will prioritize its incorporation.
Synonyms
9-27; CD 225 ; CD 225 antigen; CD225; CD225 antigen; Dispanin subfamily A member 2a; DSPA2a; IFI 17; IFI17; IFITM1; IFM1_HUMAN; Interferon induced protein 17; interferon induced transmembrane protein 1 (9-27); Interferon induced transmembrane protein 1; Interferon inducible protein 9-27; Interferon-induced protein 17; Interferon-induced transmembrane protein 1; Interferon-inducible protein 9-27; Leu 13; Leu 13 antigen; Leu-13 antigen; LEU13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-125
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MHKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYS VKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQ EKRGY
Uniprot No.

Target Background

Function

Interferon-induced transmembrane protein 1 (IFITM1) is an antiviral protein that inhibits viral entry into the host cell cytoplasm. While permitting endocytosis, it prevents subsequent viral fusion and release of viral contents into the cytosol. IFITM1 demonstrates broad-spectrum antiviral activity against numerous viruses, including influenza A virus, SARS coronaviruses (SARS-CoV and SARS-CoV-2), Marburg virus (MARV), Ebola virus (EBOV), Dengue virus (DNV), West Nile virus (WNV), human immunodeficiency virus type 1 (HIV-1), and hepatitis C virus (HCV). Its inhibitory effects encompass influenza virus hemagglutinin-mediated entry, MARV and EBOV GP1,2-mediated entry, and SARS-CoV and SARS-CoV-2 spike (S) protein-mediated entry. Beyond its antiviral role, IFITM1 is implicated in cell adhesion, growth control, and cell migration. It inhibits SARS-CoV-2 S protein-mediated syncytia formation and plays a crucial role in the antiproliferative effects of interferon-gamma, potentially by inhibiting ERK activation or arresting cell growth in the G1 phase in a p53-dependent manner. In osteoblasts, it positively regulates differentiation. In hepatocytes, IFITM proteins work in concert to restrict HCV infection, targeting endocytosed virions for lysosomal degradation. IFITM2 and IFITM3 contribute to this anti-HCV activity by inhibiting later stages of HCV entry, possibly through coordinated virion trapping in the endosomal pathway and subsequent lysosomal targeting for degradation.

Gene References Into Functions
  1. Strong IFITM1 expression in CD4 T cells in HIV controllers correlates with immune activation. PMID: 27552157
  2. IFITM1 was identified as a relevant radioresistance gene using GSE9716 data from the GEO database. Combined IFITM1 inhibition and radiotherapy may inhibit oral neoplasm cells. PMID: 29770536
  3. Inactivated viral particle inoculation increased IFITM1 mRNA and protein expression, mediating an antiviral state in HUVECs. PMID: 29100522
  4. Identification of mutations converting IFITM1 or IFITM3 from inhibitors to enhancers of MERS-CoV or SARS-CoV spike protein-mediated entry revealed key structural motifs determining biological activity. PMID: 29263263
  5. Both loss and gain of IFITM1 function dysregulate the epithelial-mesenchymal transition (EMT) signature, partially reversed by Caveolin-1 (CAV1). PMID: 27852071
  6. IFITM1 restricts alphavirus infection by inhibiting viral fusion with cellular membranes. PMID: 27219333
  7. Transcriptional regulation of IFITM1, 2, and 3 expression. PMID: 28511927
  8. IFITM1 and IFITM3 inhibit Zika virus infection early in the viral life cycle. PMID: 27268505
  9. IFITM1 suppression blocks proliferation and invasion of aromatase inhibitor-resistant breast cancer in vivo via JAK/STAT1-mediated p21 induction. PMID: 28411130
  10. IFITM1 exhibits superior performance compared to CD10 in distinguishing endometrial stroma of adenomyosis from mesenchyma surrounding invasive endometrial adenocarcinoma. PMID: 27124937
  11. IFITM1 overexpression is associated with oral squamous cell carcinomas. PMID: 27221933
  12. High IFITM1 expression correlates with poor prognosis in colorectal cancer. PMID: 26884876
  13. IFITM1 overexpression enhances the aggressive phenotype of triple-negative SUM149 IBC cells, dependent on STAT2/BRG1 interaction. PMID: 26897526
  14. IFITM proteins act coordinately to restrict HCV infection by targeting endocytosed virions for lysosomal degradation; their actions are virus and cell-type specific. PMID: 26354436
  15. The C-terminal region of IFITM1 modulates antiviral function by controlling protein subcellular localization. PMID: 25738301
  16. IFITM1 promotes colorectal cancer cell aggressiveness via caveolin-1 signaling. PMID: 26259513
  17. In virus-producing cells, IFITMs associate with forming virions and are incorporated into HIV-1 particles. PMID: 25422070
  18. Incorporation of IFITM1, IFITM2, and IFITM3 into HIV-1 virions impairs viral fusion and spread. PMID: 25464829
  19. Host IFITM3, IFITM2, and IFITM1 facilitate human cytomegalovirus assembly morphogenesis. PMID: 25552713
  20. Higher IFITM mRNA levels in cortical blood vessels in schizophrenia subjects correlate with greater disturbances in cortical GABA neurons, suggesting influence by a shared upstream immune activation insult. PMID: 24209773
  21. IFITM1 is a potential metastasis-promoting gene enhancing ovarian cancer metastasis via epigenetic transcriptional regulation. PMID: 24676393
  22. IFITM1 is a valuable addition to immunohistochemical panels for diagnosing cellular mesenchymal uterine tumors. PMID: 24072182
  23. The g.-1920G>A polymorphism in IFITM1 may be associated with ulcerative colitis (UC) susceptibility. PMID: 24120510
  24. IFITM1 is essential for functional blood vessel formation, stabilizing EC-EC interactions during lumen formation by regulating tight junction assembly. PMID: 24603679
  25. IFITMs, unlike tetherin, directly reduce HIV-1 protein expression (Gag, Vif, Nef), albeit with modest inhibitory activity. PMID: 23376165
  26. IFITM-1, IFITM-2, and IFITM-3 exhibit broad-spectrum antiviral activity against Bunyaviridae family members. PMID: 23720721
  27. IFITM1 is an interferon-stimulated gene effector against HCV entry. PMID: 22996292
  28. IFITM1 knockdown in human alveolar-derived bone marrow stromal cells inhibits Runx2 mRNA and protein expression. PMID: 22634173
  29. Anti-miR-130a introduction in hepatocytes increases IFITM1 expression, reducing HCV replication, suggesting HCV infection upregulates miR-130a. PMID: 22787204
  30. IFITM1 expression controls gastric cancer invasiveness and migration. PMID: 22609115
  31. Hepatitis C virus infection suppresses upregulation of effector molecules, including ISG56 and IFITM1. PMID: 21976647
  32. IFITM1 expression in human glioma cell lines correlates positively with tumorigenicity. PMID: 20838853
  33. IFITM proteins differentially restrict enveloped virus entry and modulate cellular tropism independently of viral receptor expression. PMID: 21253575
  34. IFITM1, IFITM2, and IFITM3 inhibit HIV-1 replication by interfering with virus entry. PMID: 21177806
  35. ULBP1, TFR2, and IFITM1 associate with increased susceptibility to Vgamma9Vdelta2 T-cell cytotoxicity. PMID: 20220060
  36. Activated IFITM1 is associated with Peutz-Jeghers syndrome polyps. PMID: 20428811
  37. IFITM1 downregulation is associated with cervical squamous cell carcinoma. PMID: 20099975
  38. Positive IFITM1 expression levels correlate with Peutz-Jeghers syndrome carcinogenetic progression. PMID: 19304549
  39. LEU13 has a novel role beyond cell proliferation inhibition, involved in IFNα-induced refractoriness of RSa cells to X-rays. PMID: 12926988
  40. IFITM1 expression profiling can be used for CML molecular classification and survival prediction. PMID: 15661263
  41. 9-27 overexpression increases migration and invasiveness by suppressing natural killer cells in gastric cancer. PMID: 15808405
  42. IFITM1 impacts cellular sensitivity to cisplatin (CDDP) in esophageal cancer. PMID: 18202764
  43. IFITM1 plays an important role in early-stage head and neck squamous cell carcinoma (HNSCC) invasion. PMID: 18829488
  44. IFITM1 and CAV-1 interaction enhances CAV-1's inhibitory effect on ERK activation. PMID: 19499152
  45. Antiviral effects of IFITM family members on H1N1 influenza, West Nile virus, and Dengue virus. PMID: 20064371
Database Links

HGNC: 5412

OMIM: 604456

KEGG: hsa:8519

STRING: 9606.ENSP00000330825

UniGene: Hs.458414

Protein Families
CD225/Dispanin family
Subcellular Location
Cell membrane; Single-pass membrane protein. Lysosome membrane.
Tissue Specificity
Bone (at protein level). Levels greatly elevated in colon cancer, cervical cancer, esophageal cancer and ovarian cancer. Expressed in glioma cell lines.

Q&A

What is IFITM1 and how does it relate to other IFITM family members?

IFITM1 is one of five proteins in the human interferon-induced transmembrane protein family. Unlike IFITM5 and IFITM10, which are not interferon-inducible, IFITM1, IFITM2, and IFITM3 are expressed ubiquitously and induced by type I, II, and III interferons due to the presence of interferon response elements (ISREs) and gamma-activated sequences (GASs) in their promoters . The IFITM gene cluster is located on chromosome 11 in humans, with orthologous genes found in numerous vertebrates including mice, non-human primates, marsupials, avian, and amphibian species . These genes were first discovered in the 1980s by the Stark and Kerr laboratories .
A key distinguishing feature of IFITM1 is its predominant localization to the plasma membrane, while IFITM2 and IFITM3 are more concentrated in endosomal compartments. This differential localization has significant implications for their antiviral specificities - IFITM1 is particularly effective against viruses that enter via the plasma membrane . Phylogenetic analysis has established evolutionary relationships between IFITM proteins across species, reflecting their conserved role in host defense.

What structural domains determine IFITM1's antiviral activity?

IFITM1 contains several structural domains critical for its antiviral function. Recent three-dimensional structure prediction and site-directed mutagenesis have identified two specific residues on IFITM1 that are essential for its antiviral activity against Epstein-Barr virus (EBV): Tyrosine 121 (Tyr 121) and Leucine 104 (Leu 104) . These residues form a 'clip-like' interaction with the extracellular domain of Ephrin receptor A2 (EphA2), a receptor that EBV uses to enter epithelial cells .
The conserved intracellular loop (CIL) domain contains sequences that determine the protein's subcellular localization to the plasma membrane. Mutations in this region can alter IFITM1's cellular distribution and consequently reduce its antiviral capacity . Experimental evidence shows that blocks of amino acids in the CIL domain, when mutated, can alter the subcellular localization of the protein and compromise its antiviral activity .
Site-directed mutagenesis studies demonstrate that altering either Tyr 121 or Leu 104 partially impairs IFITM1's inhibitory effect on EBV infection, while simultaneously mutating both residues completely abolishes this function . This finding highlights the structure-function relationship that is critical for IFITM1's antiviral mechanisms.

How does IFITM1 restrict viral infection mechanistically?

IFITM1 employs multiple mechanisms to restrict viral infection:

  • Direct inhibition of virus-cell fusion: IFITM1 can alter plasma membrane properties, creating a physical barrier that inhibits fusion between viral and cellular membranes.

  • Competitive receptor blocking: For EBV, IFITM1 directly interacts with EphA2 via its key residues (Tyr 121 and Leu 104), which competitively blocks the binding sites that EBV glycoproteins gH/gL and gB also use . This competitive binding effectively prevents EBV attachment and subsequent entry.

  • Post-entry restriction: Beyond entry inhibition, IFITM1 can reduce the expression of viral proteins from transfected proviral DNA, consequently decreasing viral production . This mechanism has been particularly observed with HIV-1, where IFITM1 restricts replication even when not affecting the entry of certain strains .
    IFITM1's plasma membrane localization enables it to restrict infection with various viruses that enter via this route, including members of the Paramyxoviridae and Pneumoviridae families such as respiratory syncytial virus (RSV), mumps virus, human metapneumovirus (HMPV), and enveloped DNA viruses like herpes simplex virus 1 (HSV-1) .

How is IFITM1 expression regulated in cells?

IFITM1 expression is regulated through multiple mechanisms:

  • Transcriptional regulation: IFITM1 gene expression is primarily induced by type I, II, and III interferons through the presence of interferon response elements (ISREs) and gamma-activated sequences (GASs) in its promoter .

  • Post-transcriptional regulation: Recent research has identified that an m6A reader protein called YTHDF3 suppresses IFITM1 via a degradation-related process involving DEAD-box protein 5 (DDX5) . This represents a novel layer of regulation that could potentially be targeted for therapeutic intervention.

  • Viral regulation: Analysis of EBV-positive epithelial cells reveals reduced IFITM1 levels compared to EBV-negative cells, suggesting viral mechanisms to downregulate this restriction factor . The negative correlation between IFITM1 expression levels and EBV copy number in clinical samples further supports this regulatory relationship .
    This multi-level regulation allows for precise control of IFITM1 expression in response to infection and other cellular stressors, ensuring appropriate host defense while preventing potential detrimental effects of excessive expression.

What are optimal methods for studying IFITM1's antiviral activity in vitro?

To rigorously assess IFITM1's antiviral activity in vitro, researchers should employ a combination of the following approaches:

  • Virus infection assays:

    • Quantify viral entry using reporter viruses expressing fluorescent proteins or luciferase

    • Measure viral replication through qPCR, plaque assays, or TCID50 determinations

    • Employ time-of-addition experiments to distinguish between entry and post-entry restriction

  • Receptor binding studies:

    • Co-immunoprecipitation (Co-IP) assays to analyze IFITM1 interaction with receptors like EphA2

    • Competition assays with viral glycoproteins to demonstrate competitive binding

    • Surface plasmon resonance or bio-layer interferometry to measure binding kinetics

  • Subcellular localization analysis:

    • Immunofluorescence microscopy to verify plasma membrane localization

    • Subcellular fractionation followed by Western blotting

    • Live-cell imaging with fluorescently tagged IFITM1 to track dynamic localization during infection

  • Mutagenesis approaches:

    • Site-directed mutagenesis of key residues like Tyr 121 and Leu 104

    • Domain swapping between IFITM family members to identify functional regions

    • Alanine scanning mutagenesis to systematically map functional residues
      Research has shown that soluble recombinant IFITM1 can effectively prevent EBV infection both in vitro and in vivo , suggesting that exogenous administration of the protein could be a viable experimental approach to study its mechanisms and potential therapeutic applications.

How can researchers effectively generate and validate IFITM1 knockdown or knockout models?

Creating reliable IFITM1 loss-of-function models requires careful experimental design and thorough validation:
RNA interference (RNAi) approaches:

  • siRNA transfection provides transient knockdown (48-72 hours)

  • shRNA delivered via lentiviral vectors enables stable knockdown

  • Design multiple targeting sequences to minimize off-target effects

  • Validate knockdown efficiency at both mRNA (RT-qPCR) and protein (Western blot) levels
    CRISPR-Cas9 genome editing:

  • Design gRNAs targeting early exons or essential domains

  • Use multiple gRNAs to ensure complete gene disruption

  • Employ HDR-mediated approaches to introduce specific mutations for structure-function studies

  • Verify knockouts through sequencing, protein blotting, and functional assays
    Mouse models:

  • Ifitm1-/- knockout mice have been generated and show increased susceptibility to viral infections, particularly RSV

  • Validate knockouts through genotyping and protein expression analysis

  • Assess phenotypes through viral challenge experiments
    Important validation considerations:

  • Assess compensatory upregulation of other IFITM family members, which may confound interpretation

  • Include appropriate controls (scrambled siRNA, non-targeting gRNAs, wild-type littermates)

  • Confirm specificity using rescue experiments with RNAi-resistant IFITM1 constructs

  • Test multiple cell lines or primary cells to ensure reproducibility
    Studies with Ifitm1-/- mice have demonstrated that RSV infection is more severe in these animals, extending the range of viruses known to be restricted by IFITM proteins in vivo . This highlights the value of knockout models in establishing physiological relevance.

What key considerations should guide IFITM1 mutagenesis studies?

When designing mutagenesis studies to investigate IFITM1 function, researchers should consider:
Target selection:

  • Focus on conserved residues across species, which often indicate functional importance

  • Target known functional domains: the conserved intracellular loop (CIL) contains residues critical for subcellular localization

  • Prioritize residues identified through structural predictions, such as Tyr 121 and Leu 104, which are critical for interaction with EphA2
    Mutation strategies:

  • Alanine scanning: Systematic replacement of residues with alanine to identify functional regions

  • Conservative vs. non-conservative substitutions: To distinguish between structural and functional roles

  • Domain swapping between IFITM family members to identify determinants of specific functions
    Validation approaches:

  • Confirm protein expression and stability of mutants through Western blotting

  • Verify subcellular localization using immunofluorescence or fractionation techniques

  • Assess antiviral activity through infection assays with multiple virus types

  • Examine protein-protein interactions through co-immunoprecipitation or proximity ligation assays
    Recent mutagenesis studies have revealed that altering Tyr 121 and Leu 104 residues on IFITM1 results in an increased binding affinity between EphA2 and viral glycoproteins like gH/gL or gB, confirming the competitive binding mechanism . This approach elegantly demonstrated how specific residues contribute to IFITM1's antiviral function.

How can researchers analyze IFITM1 interaction with viral receptors?

To comprehensively characterize IFITM1's interactions with viral receptors like EphA2, researchers should employ complementary approaches:
Biochemical methods:

  • Co-immunoprecipitation (Co-IP) to detect protein-protein interactions

  • Pull-down assays using recombinant proteins

  • Cross-linking mass spectrometry to identify interaction interfaces

  • Surface plasmon resonance or bio-layer interferometry for binding kinetics
    Structural approaches:

  • Three-dimensional structure prediction using tools like I-TASSER and SWISS-model

  • X-ray crystallography or cryo-EM of protein complexes (challenging for membrane proteins)

  • NMR studies of specific domains

  • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces
    Cell-based assays:

  • Proximity ligation assays to visualize interactions in situ

  • FRET or BRET to monitor real-time interactions

  • Competition assays with viral glycoproteins

  • Mutagenesis followed by functional assays
    Computational methods:

  • Molecular docking to predict binding modes

  • Molecular dynamics simulations to assess stability of interactions

  • Interface analysis to identify critical contact residues
    Structure prediction and site-directed mutagenesis have revealed a 'clip-like' interaction between IFITM1 and EphA2's extracellular domain . Key residues (Tyr 121 and Leu 104) on IFITM1 share binding sites with both EphA2-LBD (Val 161, Asn 60, and Met 59) and EBV gH/gL (Arg 130 and Ala 32), providing a structural basis for the competitive inhibition mechanism .

What is the relationship between IFITM1 expression and cancer progression?

IFITM1's role in cancer presents a paradoxical situation where this antiviral protein can exhibit both tumor-suppressive and oncogenic properties:
Oncogenic activities:

  • Elevated IFITM1 expression has been associated with poor therapeutic outcomes in several cancers

  • In glioma cells, IFITM1 promotes proliferation and invasion by preventing cell cycle arrest in G0-G1 phase

  • IFITM1 has been shown to negatively regulate Caveolin-1 (CAV1) and other proteins associated with cell migration and adhesion

  • In head and neck squamous cell carcinoma, high IFITM1 expression correlates with upregulation of matrix metalloproteinases
    Mechanisms in tumor progression:

  • Silencing IFITM1 expression in glioma cells decreases proliferation and invasion by inducing cell cycle arrest and reducing matrix metalloproteinase MMP9 expression

  • Matrix metalloproteinases degrade extracellular matrix proteins, triggering cellular detachment from the local tumor microenvironment and allowing migration to distal sites

  • IFITM1 is involved in IFNα-induced DNA damage resistance pathways, potentially contributing to therapy resistance
    IFITM1 may function analogously to other negative regulatory ISGs such as TREX1 and ADAR1, which can negatively regulate antitumor immunity and promote therapy resistance . This adds IFITM1 to a growing list of antiviral and immunoregulatory ISGs with dual roles in cancer biology.
    The context-dependent effects of IFITM1 in cancer highlight the importance of understanding its regulatory networks and functional interactions in specific tumor types before considering it as a therapeutic target.

What are emerging non-viral functions of IFITM1 in immune regulation?

Beyond its established antiviral roles, IFITM1 is increasingly recognized for its involvement in immune regulation:
T-cell and B-cell responses:

  • IFITMs may have roles regulating adaptive T-cell and B-cell responses

  • Studies with IFITM3-deficient Jurkat cells show attenuated TCR signaling, suggesting IFITM family members may modulate T-cell activation
    Toll-like receptor (TLR) pathways:

  • IFITMs appear to regulate TLR internalization dynamics

  • Recent evidence from both murine and human dendritic cell models suggests IFITM3 regulates TLR internalization through IFITM-dependent turnover of Nogo-B, a poorly studied innate immune signaling protein
    Inflammatory responses:

  • Numerous studies point to anti-inflammatory activities of IFITMs

  • IFITM1 may be involved in both innate antiviral and inflammatory responses
    These immunoregulatory functions appear to be highly context-specific, with effects potentially varying by cell type and activation state. The apparent contradictions in some findings suggest that IFITM1's immune effects are complex and multifaceted. Detailed studies of cell-intrinsic signaling effects in distinct immune cell populations will be necessary to reconcile seemingly disparate observations and to clarify IFITM1's role in immune regulation .

How might IFITM1's antiviral properties be leveraged for therapeutic applications?

The potent and broad-spectrum antiviral activity of IFITM1 presents several promising avenues for therapeutic development:
Soluble IFITM1 as an antiviral agent:

  • Recent research demonstrates that exogenous soluble IFITM1 effectively prevents EBV infection both in vitro and in vivo

  • This suggests potential for developing IFITM1-based biologics that could block viral entry

  • Such approaches might be particularly valuable for prophylaxis or early intervention in viral infections
    Targeting IFITM1 regulatory pathways:

  • The discovery that YTHDF3 suppresses IFITM1 via the degradation-related DEAD-box protein 5 (DDX5) provides a potential target to enhance endogenous IFITM1 levels

  • Inhibiting these negative regulators might boost IFITM1 expression and enhance antiviral defense
    Structure-guided drug design:

  • Understanding the interaction between IFITM1 and viral receptors like EphA2 could guide the development of small molecule or peptide mimetics

  • Focusing on the key residues (Tyr 121 and Leu 104) that mediate the competitive binding could lead to targeted therapeutics
    Potential therapeutic applications:

  • Prevention of EBV-associated diseases including infectious mononucleosis and certain cancers

  • Broad-spectrum antiviral prophylaxis for immunocompromised patients

  • Combination therapy with conventional antivirals targeting different stages of viral lifecycles
    The discovery that IFITM1 can prevent EBV infection by competitively blocking its receptor represents a novel mechanism that could be exploited for therapeutic intervention. Further development of soluble IFITM1 or mimetics could lead to new strategies for preventing viral infections.

What do in vivo studies reveal about IFITM1's physiological role in viral defense?

Animal models have provided crucial insights into IFITM1's physiological importance in viral defense:
Respiratory viral infections:

  • Ifitm1-/- knockout mice exhibit increased susceptibility to respiratory syncytial virus (RSV) infection

  • This finding extends the range of viruses known to be restricted by IFITM proteins in vivo

  • The increased disease severity in knockout mice suggests that IFITM1 plays a non-redundant role in controlling RSV infection that cannot be fully compensated by other IFITM family members
    EBV infection models:

  • Exogenous soluble IFITM1 effectively prevents EBV infection in vivo

  • This confirms the translational potential of IFITM1's antiviral mechanism from in vitro observations to physiological settings
    Evolutionary conservation:

  • Functional studies of IFITM orthologs in mice and macaques show that IFITMs protect against virus infection across species

  • This evolutionary conservation underscores the fundamental importance of IFITM-mediated antiviral defense
    These in vivo findings highlight IFITM1's critical role in host defense against viral pathogens beyond what can be observed in cell culture systems, validating its physiological relevance and potential therapeutic applications.

What is currently known about IFITM1's three-dimensional structure?

Understanding of IFITM1's three-dimensional structure has advanced through computational and experimental approaches:
Structural predictions:

  • Three-dimensional structure prediction using tools like I-TASSER and SWISS-model has generated models of IFITM1 and its interactions

  • These predictions suggest a topology where specific domains interact with membrane lipids while others extend into intra- or extracellular spaces

  • Recent models predict a 'clip-like' interaction between IFITM1 and the extracellular domain of receptors like EphA2
    Key structural features:

  • Two critical residues, Tyrosine 121 (Tyr 121) and Leucine 104 (Leu 104), have been identified as essential for IFITM1's interaction with EphA2

  • These residues share binding sites with both EphA2's ligand-binding domain (Val 161, Asn 60, and Met 59) and EBV glycoproteins (Arg 130 and Ala 32)

  • This structural arrangement explains the competitive inhibition mechanism underlying IFITM1's anti-EBV activity
    Topology and membrane integration:

  • IFITM1 is a small transmembrane protein with both intracellular and extracellular portions

  • The conserved intracellular loop (CIL) domain contains sequences critical for subcellular localization

  • The specific membrane topology of IFITM1 positions it to interact with viral receptors at the cell surface
    The current structural models provide valuable insights into IFITM1's mechanism of action, particularly regarding its competitive binding to viral receptors. Further experimental structural studies will be essential for fully elucidating IFITM1's three-dimensional architecture.

How do rare genetic variants in IFITM1 affect its function?

Genetic variations in IFITM1 can significantly impact its antiviral function:
Identified variants:

How does IFITM1 interact with other interferon-stimulated genes in the antiviral response?

IFITM1 functions within a complex network of interferon-stimulated genes (ISGs), with various interactions and cooperative effects:
Cooperative antiviral mechanisms:

  • IFITM1 primarily targets viral entry at the plasma membrane, while other ISGs restrict different phases of viral lifecycles

  • This creates a multi-layered defense system where IFITM1 works alongside genes like MDA5, OAS-1, and Mx1

  • The collective action of these ISGs provides broad-spectrum protection against diverse viral pathogens
    Regulatory interactions:

  • Some ISGs may modulate IFITM1 expression or function through direct or indirect mechanisms

  • Conversely, IFITM1 may influence the expression or activity of other antiviral effectors

  • This creates a complex regulatory network that can be dynamically adjusted according to the specific viral threat
    Context-specific interactions:

  • The composition and interaction of the ISG network varies between cell types

  • In specific cellular contexts, IFITM1 may interact with tissue-specific factors that modify its function

  • These context-specific interactions may explain differential antiviral efficacy across tissues
    Understanding these interactions requires systems biology approaches to map the complex interplay between IFITM1 and other components of the interferon response. Such knowledge will be valuable for developing strategies to enhance antiviral immunity or to overcome viral evasion mechanisms.

What viral evasion strategies target IFITM1?

Viruses have evolved various mechanisms to overcome IFITM1-mediated restriction:
Downregulation of IFITM1 expression:

  • RNA-sequencing and clinical sample analysis show reduced IFITM1 in EBV-positive epithelial cells compared to EBV-negative cells

  • A negative correlation exists between IFITM1 level and EBV copy number in clinical samples

  • This suggests that EBV has developed mechanisms to suppress IFITM1 expression
    Exploitation of cellular regulatory pathways:

  • Recent research has identified that YTHDF3, an m6A reader protein, suppresses IFITM1 via a degradation-related process involving DEAD-box protein 5 (DDX5)

  • Viruses might potentially hijack this pathway to reduce IFITM1 levels
    Alternative entry mechanisms:

  • Some viruses may utilize entry routes that bypass IFITM1-mediated restrictions

  • Entry through cellular compartments where IFITM1 is less abundant could provide an evasion strategy
    Direct antagonism:

  • Viral proteins might directly interact with IFITM1 to neutralize its antiviral activity

  • Such interactions could prevent IFITM1 from reaching its site of action or interfere with its binding to cellular receptors
    Understanding these evasion mechanisms is crucial for developing strategies to enhance IFITM1's antiviral efficacy or for designing antiviral therapeutics that can overcome viral countermeasures. The dynamic interplay between host restriction factors like IFITM1 and viral evasion strategies represents an ongoing evolutionary arms race.

What cutting-edge technologies are advancing IFITM1 research?

Several emerging technologies are transforming our understanding of IFITM1 biology:
Structural biology techniques:

  • Cryo-electron microscopy of membrane proteins in nanodiscs

  • Advanced NMR methods for membrane protein structure determination

  • Hydrogen-deuterium exchange mass spectrometry for mapping protein interactions

  • Computational approaches like AlphaFold for structure prediction
    Genome editing technologies:

  • CRISPR-Cas9 for precise genetic manipulation

  • Base editing for introducing specific point mutations

  • Prime editing for targeted insertions and deletions

  • CRISPRi/CRISPRa for reversible gene expression modulation
    Advanced imaging techniques:

  • Super-resolution microscopy for visualizing IFITM1 distribution and clustering

  • Live-cell imaging to track dynamic changes during viral infection

  • Correlative light and electron microscopy to link functional observations with ultrastructural details

  • Proximity labeling (BioID, APEX) to map protein interaction networks
    Single-cell technologies:

  • Single-cell RNA-seq to reveal cell-specific expression patterns

  • Single-cell proteomics to identify protein-level changes

  • CITE-seq to correlate surface protein expression with transcriptomic profiles

  • Spatial transcriptomics to map IFITM1 expression in tissue contexts
    These technologies are enabling researchers to address previously intractable questions about IFITM1's structure, function, and regulation. Integration of multiple cutting-edge approaches will be necessary to fully elucidate IFITM1's complex biology and therapeutic potential.

What methodological challenges exist in studying IFITM1-virus interactions?

Researchers face several methodological challenges when investigating IFITM1-virus interactions:
Membrane protein biochemistry:

  • Difficulties in expressing and purifying functional IFITM1 due to its membrane-associated nature

  • Challenges in maintaining native conformation during isolation procedures

  • Limited solubility affecting structural and functional studies

  • Need for specialized detergents or membrane mimetics
    Virus-specific considerations:

  • Biosafety requirements when working with pathogenic viruses

  • Variability in viral stocks affecting reproducibility

  • Limitations of pseudotyped virus systems in fully recapitulating authentic viral entry

  • Technical challenges in visualizing virus-IFITM1 interactions at the single-molecule level
    Cellular complexity:

  • Cell type-specific differences in IFITM1 expression and function

  • Compensatory mechanisms when manipulating IFITM1 expression

  • Redundancy among IFITM family members complicating interpretation

  • Heterogeneity in viral susceptibility among cells
    In vivo translation:

  • Gap between in vitro findings and physiological relevance

  • Limitations of animal models in representing human IFITM1 function

  • Challenges in delivering therapeutics targeting IFITM1 pathways

  • Complexity of immune responses in whole-organism contexts Addressing these challenges requires multidisciplinary approaches and the development of new methodologies specifically tailored to membrane protein-virus interactions. Collaborative efforts between virologists, structural biologists, cell biologists, and immunologists will be essential for overcoming these obstacles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.