Recombinant Human Interferon-induced transmembrane protein 5 (IFITM5)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes; we will fulfill your request to the best of our ability.
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes; we will fulfill your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
IFITM5; Interferon-induced transmembrane protein 5; Bone-restricted interferon-induced transmembrane protein-like protein; BRIL; Dispanin subfamily A member 1; DSPA1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-132
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
IFITM5
Target Protein Sequence
MDTAYPREDTRAPTPSKAGAHTALTLGAPHPPPRDHLIWSVFSTLYLNLCCLGFLALAYS
IKARDQKVVGDLEAARRFGSKAKCYNILAAMWTLVPPLLLLGLVVTGALHLARLAKDSAA
FFSTKFDDADYD
Uniprot No.
Target Background
Function
Essential for normal bone mineralization.
Gene References Into Functions
- Two IFITM5 mutations causing distinct osteogenesis imperfecta forms. PMID: 24478195
- The c.-14C>T point mutation in the IFITM5 5'-untranslated region is responsible for osteogenesis imperfecta type V in Chinese patients. PMID: 23977282
- IFITM5 5' UTR sequencing in 9 heterozygous osteogenesis imperfecta type V subjects revealed both wild-type and mutant mRNA transcripts in bone. Identical mutations exhibit variable phenotypic expression, even within families. PMID: 24674092
- Significant bone mineral density variation observed, even within families. This highlights the phenotypic variability of OI type V caused by IFITM5 mutation. PMID: 23408678
- A recurrent mutation in the IFITM5 5'-UTR causes osteogenesis imperfecta type V. PMID: 23813632
- IFITM5 mutation associated with Osteogenesis imperfecta type V. PMID: 23804581
- Study demonstrates a recurrent IFITM5 mutation in osteogenesis imperfecta type V patients; considerable interindividual phenotypic variability exists despite identical mutations. PMID: 23240094
- A single recurrent mutation in the IFITM5 5'-UTR causes osteogenesis imperfecta type V. PMID: 22863190
- An IFITM5 5'-UTR mutation creates an in-frame start codon, causing autosomal-dominant osteogenesis imperfecta type V with hyperplastic callus. PMID: 22863195
Database Links
Involvement In Disease
Osteogenesis imperfecta 5 (OI5)
Protein Families
CD225/Dispanin family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in bone. Detected in osteoblasts and fibroblasts (at protein level). Detected in bone. Detected in osteoblasts and fibroblasts.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
