Recombinant Human Interleukin-7 (IL7)

Shipped with Ice Packs
In Stock

Description

T-Cell Regulation

  • Development: Essential for thymopoiesis and T-cell maturation in humans, as shown by severe T-cell deficiency in IL-7Rα-mutated SCID patients .

  • Survival: Upregulates anti-apoptotic proteins Bcl-2 and Mcl-1, promoting naïve and memory T-cell maintenance .

  • Homeostasis: Reverses age-related T-cell decline, increasing CD4+ and CD8+ counts in clinical trials .

B-Cell and Innate Immune Modulation

  • B-Cell Development: Supports pre-B cell proliferation in mice but is dispensable in humans .

  • NK/ILC Activation: Enhances NK cell cytotoxicity and IFN-γ production in multiple sclerosis and viral infections .

Therapeutic Uses

ConditionStudy OutcomeReference
Cancer ImmunotherapyDose-dependent CD4+/CD8+ T-cell expansion (2–3× baseline) with sustained effects for 2+ months
HIV/HAART AdjunctImproved gut mucosal repair and reduced systemic inflammation
Post-Hematopoietic TransplantDoubled T-cell counts, enhanced viral-specific T-cell function without GVHD exacerbation

Pharmacokinetics

  • Half-Life: 5–9 hours post-subcutaneous administration .

  • Dose Response: Biologically active at ≥10 µg/kg, peaking at 3 weeks .

  • Bone Marrow Effects: Transient pre-B cell proliferation observed at higher doses .

Future Directions

  • Combination Therapies: Synergy with checkpoint inhibitors or IL-15 for cancer .

  • Manufacturing Innovations: GMP-grade IL-7 for scalable cell therapy production .

  • Biomarker Development: Circulating IL-7 levels as a predictor of lymphopenic states .

Product Specs

Buffer
For liquid delivery forms, the default storage buffer is a Tris/PBS-based buffer containing 5%-50% glycerol.

Note: If you have a specific requirement for the glycerol content, please indicate it in your order remarks.

For lyophilized powder delivery forms, the buffer used prior to lyophilization is a Tris/PBS-based buffer containing 6% Trehalose.
Description

Recombinant human interleukin-7 (IL7) is produced using recombinant DNA technology. This involves co-inserting the DNA fragment encoding the 26-177aa of IL7 protein with the N-terminal 6xHis-SUMO-tag gene into an expression vector. The recombinant vector is then cultured in vitro using an E.coli expression system for protein expression. The recombinant human IL7 is harvested from the cell culture supernatant and undergoes affinity chromatography purification. Its purity reaches up to 90%, as determined by SDS-PAGE.

Human IL7 is a crucial hematopoietic growth factor involved in various immune processes. It plays a vital role in the development of thymic T cells, lymphoid homeostasis, and peripheral T cell survival [1]. IL7 is expressed in human intestinal epithelial cells and contributes to the functional differentiation of CD4+ T cells, impacting mucosal immunity [2]. IL7 also influences the differentiation of human neural progenitor cells, suggesting its involvement in neuronal tissue development and plasticity [3]. The aberrant expression of IL7 isoforms is found in human cancer tissues, highlighting its potential functions as tumor growth and differentiation factors [4].

References:
[1] R. O’Connell, A. Balazs, D. Rao, C. Kivork, L. Yang, & D. Baltimore, Lentiviral vector delivery of human interleukin-7 (hil-7) to human immune system (his) mice expands t lymphocyte populations, Plos One, vol. 5, no. 8, p. e12009, 2010. https://doi.org/10.1371/journal.pone.0012009
[2] K. Katamura, T. Fukui, T. Kiyomasu, K. Ohmura, J. Iio, & H. Ueno, Regulation of cd31 expression and interleukin‐4 production by human cord blood cd4+ t cells with interleukin‐4 and interleukin‐7, Pediatrics International, vol. 42, no. 2, p. 126-133, 2000. https://doi.org/10.1046/j.1442-200x.2000.01194.x
[3] M. Moors, N. Vudattu, J. Abel, U. Krämer, L. Rane, N. Ulfiget al., Interleukin-7 (il-7) and il-7 splice variants affect differentiation of human neural progenitor cells, Genes and Immunity, vol. 11, no. 1, p. 11-20, 2009. https://doi.org/10.1038/gene.2009.77
[4] N. Vudattu, I. Magalhaes, H. Hoehn, D. Pan, & M. Maeurer, Expression analysis and functional activity of interleukin-7 splice variants, Genes and Immunity, vol. 10, no. 2, p. 132-140, 2008. https://doi.org/10.1038/gene.2008.90

Form
The product is available in both liquid and lyophilized powder formats.
Note: We will prioritize shipping the format currently in stock. If you have a specific format preference, please specify it in your order remarks. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please contact your local distributor.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 6xHis-SUMO-tagged
Synonyms
IL7; Interleukin-7; IL-7
Datasheet & Coa
Please contact us to get it.
Expression Region
26-177aa
Mol. Weight
33.4kDa
Protein Length
Full Length of Mature Protein
Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Immunology
Source
in vitro E.coli expression system
Species
Homo sapiens (Human)
Target Names
IL7
Target Protein Sequence
DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is essential for proliferation during certain stages of B-cell maturation.
Gene References Into Functions
  1. Human IL-7 binds more strongly to stretched than to relaxed Fibronectin. PMID: 28845674
  2. Downregulation of IL-7 and T follicular helper cells (Tfh) might contribute to viral persistence in hepatitis C virus (HCV)infection. The in vitro study revealed an immunopotentiator of IL-7 in chronic HCV infection, which manifested as IL-7-regulated HCV-specific and nonspecific activated Tfh cells. PMID: 29672235
  3. These data indicate the involvement of IL-7 into a direct upregulation of growth and functional activity of human T cells in the absence of antigenic stimulus and the relative scarcity of costimulatory effects. PMID: 30193429
  4. these findings add further evidence that IL-7 is a key regulatory factor that may tune the balance between functionally different T-cell subsets following haematopoietic stem cell transplantation PMID: 29033080
  5. The constitutively signaling C7R system developed here delivers potent IL7 stimulation to CAR T cells, increasing their persistence and antitumor activity against multiple preclinical tumor models, supporting its clinical development PMID: 28830878
  6. we demonstrated that Imatinib mesylate (IM)impaired T cell survival through the inhibition of IL-7 and STAT5-p but not TCR signaling which remained unaffected during IM therapy. Thus, off-target inhibitory effects of IM on IL-7 and STAT5-p explain how T cell lymphopenia occurs in patients treated with IM. PMID: 28387753
  7. In this study, authors compared the concentrations of IL-15 and IL-7 in the plasma of MDS patients (n = 20) compared with that in the plasma of healthy controls (n = 20). PMID: 27036031
  8. Data strongly implicate IL-7 in the thymus-independent long-term survival of functional naive-Tregs. PMID: 26910841
  9. the critical role played by IL-7 and IL-15 in T cell homeostasis and how these cytokines could be used to improve immune reconstitution after allogeneic SCT. PMID: 26795458
  10. IL-7/IL-7R signaling pathway plays a possible role in recurrent pregnancy loss by upregulating Th17 immunity while downregulating Treg immunity. PMID: 27767237
  11. IL-7 inhibits the osteogenic differentiation of Periodontal ligament stem cells probably via inactivation of mitogen-activated protein kinase (MAPK) signaling pathway. PMID: 27579861
  12. this study shows that IL-7 restores T Lymphocyte immunometabolic failure in septic shock patients through mTOR activation PMID: 28724580
  13. In CRC, IL-7 was higher in patients with lymph node and distant metastases and with tumors located in right colon. In adenomas, IL-7 elevation was associated exclusively with villous growth pattern, while in IBD, circulating IL-7 reflected clinical activity of Crohn's disease and ulcerative colitis. PMID: 27866242
  14. Tuberculosis patients had lower soluble IL-7R and higher IL-7 plasma concentrations as compared to healthy contacts. PMID: 28582466
  15. CD56(bright) NK IL-7Ralpha expression negatively associates with HCV level, and IL-7-induced NK function is impaired during HCV and HIV infections PMID: 28400540
  16. IL-7 has a role inducing epitope masking of gammac protein in IL-7 receptor signaling complex PMID: 28127156
  17. Therefore, generalized CD8+ T-cell impairment in HCV infection is characterized, in part, by impaired IL-7-mediated signalling and survival, independent of CD127 expression. This impairment is more pronounced in the liver and may be associated with an increased potential for apoptosis. This generalized CD8+ T-cell impairment represents an important immune dysfunction in chronic HCV infection that may alter patient health. PMID: 27315061
  18. These results reveal a novel role of IL-7 and IL-15 in maintaining human T cell function, provide an explanation for T cell dysfunction in humanized mice, and have significant implications for in vitro studies with human T cells. PMID: 27855183
  19. The results show that SNPs in IL7 caused a significant association in this OA Chinese Han population. PMID: 27235388
  20. IL-7 is capable of enhancing functional T cell activity without causing significant functional inbalance between various T cell subsets. PMID: 28396296
  21. In summary, our study demonstrates that IL-7/IL-7R axis promotes the invasion and migration of prostate cancer cells, through activation of AKT/NF-kappaB pathway and upregulation of MMP-3 and MMP-7 expression PMID: 27611862
  22. review of role of IL-7 in immunity and its role in the pathogenesis of neoplasia [review] PMID: 28314253
  23. Indian patients with primary Sjogren's syndrome have higher salivary sL-selectin and IL-7 levels than healthy controls PMID: 27620619
  24. increased IL-7 was secreted by mesenchymal stem cells (MSC) in the bone marrow, which may protect leukemic cells from apoptosis induced by imatinib through JAK1/STAT5 signaling pathway PMID: 27272942
  25. The results from this study suggested for the first time that miR-181c was able to negatively regulate the production of proinflammatory cytokines IL-7 and IL-17 in myasthenia gravis patients. PMID: 25962782
  26. Increase in serum IL-7 is associated with adenoma. PMID: 25793917
  27. provides negative feedback on its own signaling in T cells via endocytosis and degradation of its receptor, CD127 PMID: 26272555
  28. Observed highly significant reductions in the concentration of circulating interleukin (IL)-16, IL-7, and Vascular Endothelial Growth Factor A (VEGF-A) in encephalomyelitis/chronic fatigue syndrome patients. PMID: 26615570
  29. The observations suggest that IL-7 may play a role in the pathogenesis of Graves' disease and may be associated with its clinical activity. PMID: 26113403
  30. IL-7 and SCF are elevated for a prolonged period after double umbilical cord blood transplantation and persistently high levels of these cytokines may correlate with worse clinical outcomes. PMID: 26177551
  31. IL7 was expressed primarily in the infundibulum and suprabulb of the hair follicle. IL7 expression was increased in cutaneous T-cell lymphoma. PMID: 26479922
  32. this study identified that IL-7, as well as the Akt/ mTOR signaling pathway, effectively modulates human Double-Negative T Cell- mediated suppression of allogeneic T cell responses. PMID: 26324773
  33. IL-7/IL-17 axis mediates chronic pelvic pain in experimental autoimmune prostatitis and in patients. PMID: 25933188
  34. In view of the important role IL-7 plays in lymphocyte proliferation, homeostasis and survival, down regulation of CD127 by Tat likely plays a central role in immune dysregulation and CD4 T-cell decline PMID: 25333710
  35. decreased IL-7 in peripheral blood, maybe, is a consequence of the negative feedback of the pro-inflammatory function in ITP patients. PMID: 24750122
  36. Septic patients showed the lowest levels of IL-7. Patients with severe sepsis reached levels of IL-7 higher than those observed in the groups of uncomplicated sepsis and septic shock. PMID: 25169828
  37. These observations provide evidence of a novel mechanism that enables cells to optimally use IL-7. PMID: 25870237
  38. blocking IL-7 in hMSCs-lymphocytes co-cultures increased lymphocytes apoptosis and we also have demonstrated that hMSCs are able to produce this interleukin PMID: 25184791
  39. The present data indicate that high plasma levels of IL-7 in the early post-transplant period are predictive for slow T cell reconstitution, increased risk of acute graft-versus-host disease and increased mortality following haematopoietic stem cell transplantation. PMID: 25263171
  40. IL-7 elevates miR-124 to decrease the expression of splicing regulator PTB and represses CD95 mRNA splicing. PMID: 25411246
  41. These results strongly suggest that IL-7/IL-7R prevents apoptosis by upregulating the expression of bcl-2 and by downregulating the expression of bax PMID: 24695377
  42. These data suggest that increased IFN-alpha activity may promote the loss of T cells by accelerating cell turnover and activation-induced cell death while decreasing the renewal of T cells by inhibiting the proliferative effect of IL-7. PMID: 25063872
  43. Diminished T-cell responsiveness to IL-7. PMID: 24585897
  44. Low-level transient antigenic stimuli during cART were not associated with changes in the thymic function or the IL-7/CD127 system. PMID: 24820104
  45. IL-7 can have a significant impact in sustaining expansion and persistence of adoptively chimeric antigen receptor-redirected cytotoxic T lymphocytes. PMID: 24097874
  46. IL-23 does not induce IL-7 expression in microglia and astrocytes. PMID: 24224652
  47. Changes of IL-7 expression in different phases of Graves ophthalmopathy (GO) suggested that IL-7 may play an important role in the pathogenesis of GO. PMID: 23188693
  48. These results suggest that ineffective responses to IL-7 could impair the transition to memory cells of naive CD4(+) T lymphocytes recognizing self-peptides in the setting of strong costimulation. PMID: 23454917
  49. our data point toward an unexpected new role for IL-7 as a potential autocrine mediator of lymphatic drainage PMID: 23963040
  50. our data show that IL-7 negatively regulates Tregs PMID: 23966629

Show More

Hide All

Database Links

HGNC: 6023

OMIM: 146660

KEGG: hsa:3574

STRING: 9606.ENSP00000263851

UniGene: Hs.591873

Protein Families
IL-7/IL-9 family
Subcellular Location
Secreted.

Q&A

What is the fundamental biological role of IL-7 in the immune system?

IL-7 is a 25 kDa cytokine belonging to the hemopoietin family that plays essential roles in lymphocyte differentiation, proliferation, and survival . Unlike other common gamma-chain cytokines, IL-7 has unique effects on both T and B cell lineages. Methodologically, researchers can observe IL-7's effects through flow cytometry analysis of lymphocyte populations in both in vitro and in vivo systems, paying particular attention to CD3+, CD4+, and CD8+ T cell subsets which show marked expansion following IL-7 administration . Studies have demonstrated that IL-7 administration results in a rejuvenated circulating T cell profile that resembles earlier life stages, suggesting its fundamental role in maintaining T cell homeostasis .

How does IL-7 signaling differ from other common gamma-chain cytokines?

While IL-7 shares the common gamma chain (γc) with cytokines like IL-2 and IL-15, its receptor complex and downstream signaling pathways have distinct features. To investigate these differences experimentally, researchers typically examine JAK-STAT pathway activation patterns, particularly focusing on STAT5 phosphorylation following cytokine stimulation. IL-7 demonstrates a more focused effect on lymphoid development with less pronounced inflammatory activation compared to IL-2 and IL-15, explaining its more favorable toxicity profile in clinical applications . When analyzing signaling mechanisms, researchers should employ both phospho-flow cytometry and Western blot techniques to quantify pathway activation across multiple timepoints post-stimulation.

How can recombinant IL-7 be optimized for enhancing CAR-T cell therapy?

Recombinant human IL-7 significantly enhances CAR-T cell proliferation, persistence and cytotoxicity in both xenogeneic and syngeneic mouse models . For experimental optimization, researchers should consider:

  • Timing of administration: IL-7 can be used during ex vivo expansion phases and/or as an in vivo adjuvant post-infusion

  • Combination strategies: IL-7 is frequently combined with IL-15 during cell culture to support CAR-T expansion while maintaining early differentiation states

  • Delivery format: Long-acting forms like rhIL-7-hyFc (a homodimeric IL-7 molecule fused to a stable hybrid Fc platform) demonstrate pharmacological advantages over native rhIL-7 due to extended half-life

When designing experiments, researchers should include appropriate controls comparing IL-7 alone, IL-7/IL-15 combinations, and standard expansion protocols, with readouts including CAR-T proliferation, persistence, differentiation status, and tumor killing capacity.

What methodological approaches can be used to evaluate IL-7's impact on T cell subpopulations?

To rigorously assess IL-7's effects on T cell subpopulations, researchers should implement multi-parameter flow cytometry panels including markers for:

  • Differentiation stages: CD45RA, CCR7 to identify naive (CD45RA+CCR7+), central memory (CD45RA-CCR7+), and effector memory (CD45RA-CCR7-) populations

  • Proliferation markers: Ki-67 to quantify cycling cells, which typically show transient increases following IL-7 administration

  • Recent thymic emigrants: CD31+ cells which may increase following IL-7 treatment

  • Regulatory T cells: CD4+CD25+FOXP3+ population, which notably does not significantly increase following IL-7 administration

Data from clinical studies demonstrate that IL-7 administration primarily increases naive and central memory CD4+ T cells while minimally affecting regulatory T cells . For comprehensive analysis, researchers should collect samples at multiple timepoints (pre-treatment, 1-2 weeks, and 3 months post-treatment) to capture both immediate proliferative responses and long-term population changes.

What are the optimal dosing strategies for rhIL-7 in experimental models?

Based on clinical studies, the most biologically active dosing range for subcutaneous administration of rhIL-7 is 10-60 μg/kg/dose . For research protocols, consider:

  • Administration schedule: Typically given every other day for 2 weeks in clinical settings

  • Dose escalation design: Starting at 3 μg/kg and escalating to 10, 30, and 60 μg/kg allows for safety assessment

  • Route of administration: Subcutaneous injection is standard, though alternative routes may be explored for specific applications

Biological activity can be defined as achieving at least a 50% increase over baseline in peripheral blood CD3+ cell counts . When designing dose-finding studies, researchers should include pharmacokinetic sampling following both first and final doses to assess for potential changes in drug metabolism with repeated administration.

What methods should be used for accurate measurement of serum IL-7 levels in research samples?

For precise quantification of serum IL-7 levels, a two-site sandwich ELISA approach is recommended . Key methodological considerations include:

  • Antibody selection: Use anti-rhIL-7 monoclonal antibodies, one for capture (coating) and another biotinylated antibody for detection

  • Standard curve preparation: Ensure linear relationship between rhIL-7 concentrations and optical density measurements (typically linear up to 200 pg/ml)

  • Lower limit of detection: Concentrations below 12.5 pg/ml are typically treated as zero for pharmacokinetic calculations

  • Analysis software: Utilize specialized pharmacokinetic software (e.g., Kinetica) with non-compartmental extravascular models

For half-life determination, samples should be collected at multiple timepoints, with calculations typically performed between Tmax (approximately 2 hours) and 24 hours post-administration . These methods allow for accurate assessment of both endogenous IL-7 levels and exogenously administered rhIL-7 pharmacokinetics.

How does repeated administration of rhIL-7 affect immune parameters in long-term studies?

Phase II clinical trials have demonstrated that repeated cycles of rhIL-7 administration (20 μg/kg) can effectively maintain CD4 T-cell counts above 500 cells/μL, which is associated with improved clinical outcomes in immunodeficient conditions . When designing long-term studies, researchers should consider:

  • Monitoring frequency: Regular assessment of CD4 counts to determine timing of repeat dosing (typically when CD4 counts fall below 550 cells/μL)

  • Antibody development: Testing for anti-rhIL-7 binding and neutralizing antibodies, which develop in 77-82% and 37-38% of patients respectively after the second cycle

  • Immune subset analysis: Following naive, central memory, effector memory, and regulatory T cell populations over time

  • Duration of effect: Data shows patients can spend >63% of follow-up time with CD4 counts >500 cells/μL with appropriate repeat dosing

Importantly, research has shown that despite antibody development, CD4 T-cell responses to rhIL-7 remain robust with repeated cycles, suggesting continued biological activity .

What are the methodological considerations for studying IL-7's effects on viral reservoirs in HIV research?

When investigating IL-7's impact on viral reservoirs in HIV research, several methodological considerations are essential:

  • Viral load monitoring: Include frequent sampling (at least weekly during administration) to detect transient viral "blips" that may occur due to IL-7-induced T cell proliferation

  • Proviral DNA quantification: Measure HIV DNA in peripheral blood mononuclear cells before and after IL-7 administration

  • Cell subset analysis: Quantify virus-containing cells within specific T cell subpopulations (naive, central memory, effector memory)

  • Integration site analysis: Assess whether IL-7 affects the clonality of the viral reservoir

Studies have shown that while IL-7 may maintain the latent HIV reservoir through homeostatic proliferation, it may also activate HIV RNA expression, making its net effect on the infectious viral reservoir complex and worthy of detailed investigation . Researchers should design studies that can distinguish between expansion of infected cells versus new infection events.

How can researchers optimize long-acting IL-7 formulations for enhanced therapeutic effect?

Engineering long-acting IL-7 formulations represents an important research direction. The rhIL-7-hyFc molecule (efineptakin alfa, NT-I7) demonstrates significant advantages through:

  • Hybrid Fc fusion: Creates a homodimeric molecule that prevents complement activation while extending serum half-life

  • Structural modifications: Can be engineered to optimize receptor binding while minimizing unwanted effects

  • Delivery systems: Beyond protein engineering, researchers should explore polymer-based slow-release systems and lipid nanoparticle formulations

When evaluating novel formulations, researchers should conduct comparative studies assessing pharmacokinetics, receptor binding kinetics, biological activity in primary human lymphocytes, and in vivo efficacy in relevant disease models. The goal should be to develop formulations that maintain biological activity while reducing administration frequency.

What approaches can address the challenge of anti-IL-7 antibody development in repeated dosing protocols?

Development of both binding and neutralizing antibodies against rhIL-7 occurs in a significant percentage of patients receiving multiple treatment cycles . To address this challenge:

  • Manufacturing process optimization: Reduce protein aggregates which contribute to immunogenicity

  • Protein engineering: Modify potentially immunogenic epitopes while preserving biological function

  • Immunological tolerance induction: Explore combined administration with tolerogenic agents

  • Alternative delivery routes: Test whether mucosal or intradermal delivery might reduce antibody development

When investigating these approaches, researchers should employ robust immunogenicity assays that can distinguish between binding and neutralizing antibodies, and correlate antibody development with changes in pharmacokinetics and biological response parameters .

Table 1: Comparison of IL-7 Effects Across T Cell Subpopulations Before and After Administration

Cell PopulationBaseline (%)4 Weeks Post-IL-7 (%)3 Months Post-IL-7 (%)Key Functional Impact
CD4+CD31+ cells24.5Not reported29.7Enhanced thymic output
Central memory54.0Not reported55.1Improved immunological memory
Effector memory14.2Not reported11.4Reduced terminally differentiated cells
Naive CD4+28.633.126.8Transient increase in naive repertoire
Regulatory T cells2.3Not reported2.2Minimal impact on immunoregulation

Data derived from clinical study subset analysis following first cycle of rhIL-7 administration

How might IL-7 be utilized in combination immunotherapy approaches?

Emerging research suggests IL-7 has significant potential in combination immunotherapy strategies. When designing such studies, researchers should consider:

  • Combination with checkpoint inhibitors: IL-7's T cell expansion effects may complement the T cell activation provided by anti-PD-1/PD-L1 therapies

  • Sequential administration protocols: Determine optimal timing between IL-7 administration and other immunotherapeutic agents

  • Tissue-specific delivery: Explore intra-tumoral or tumor-adjacent delivery of IL-7 to enhance local immune responses

Preclinical studies indicate that IL-7 may enhance CAR-T cell efficacy when used as an adjuvant, suggesting broader applications in adoptive cell therapy approaches . Researchers should design factorial experimental protocols that can identify synergistic versus additive effects between IL-7 and other immunomodulatory agents.

What methodological approaches can best assess IL-7's impact on gut barrier integrity and inflammation?

IL-7 administration has been linked to improvements in gut barrier integrity and reductions in inflammatory markers in some studies . For rigorous investigation of these effects, researchers should implement:

  • Direct barrier function assessment: Measure intestinal permeability using lactulose/mannitol recovery tests or endoscopic sampling with ex vivo permeability assays

  • Inflammatory biomarker panels: Include soluble CD14, D-dimers, C-reactive protein, and cytokine profiling

  • Microbiome analysis: Assess whether IL-7-induced barrier improvements affect microbial translocation and composition

  • Tissue imaging: Perform immunohistochemistry on gut biopsies to evaluate tight junction protein expression and mucosal immune cell populations

Longitudinal sampling before and after IL-7 administration (particularly at the 3-month timepoint) is critical for capturing these effects, as some inflammatory markers may show delayed responses relative to the immediate T cell proliferation induced by IL-7 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.