Recombinant Human Inward rectifier potassium channel 13 (KCNJ13)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Inward Rectifier Potassium Channel 13 (KCNJ13)

Recombinant Human Inward Rectifier Potassium Channel 13 (KCNJ13), also known as Kir7.1, is a voltage-independent potassium channel encoded by the KCNJ13 gene. It plays critical roles in ion homeostasis, particularly in epithelial and smooth muscle cells. The recombinant form is produced via heterologous expression in E. coli and is widely used in biochemical and pharmacological studies to investigate its structural and functional properties .

Protein Characteristics

The recombinant KCNJ13 protein is engineered with an N-terminal His tag (6xHis) for purification and detection. Key specifications include:

ParameterValue
Gene SymbolKCNJ13
UniProt IDO60928
SpeciesHuman
SourceE. coli
TagN-terminal His tag
Protein LengthFull-length (1–360 amino acids)
FormLyophilized powder
Purity>90% (SDS-PAGE confirmed)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); glycerol (5–50%) recommended for storage

Applications in Research

Recombinant KCNJ13 is utilized in:

  • SDS-PAGE Analysis: To confirm protein integrity and purity .

  • Ion Channel Studies: Investigating potassium transport mechanisms and membrane potential regulation .

  • Disease Modeling: For studying retinal degeneration (e.g., Leber congenital amaurosis) and smooth muscle disorders .

  • Drug Discovery: Testing inhibitors like VU590, which modulates Kir7.1 activity .

Role in Tissue Development

  • Tracheal Smooth Muscle (SM) Alignment: KCNJ13 maintains ion homeostasis in SM cells, enabling actin polymerization and tissue architecture. Mutations disrupt SM cell polarity, leading to tracheal shortening .

  • Retinal Pigment Epithelium (RPE): Kir7.1 regulates K⁺ recycling in the subretinal space, critical for photoreceptor survival. Loss-of-function mutations cause degeneration .

Mechanistic Insights

  • Membrane Depolarization: KCNJ13 inhibition (e.g., with VU590) depolarizes SM cells, reducing F-actin levels and impairing cytoskeletal organization .

  • AKT Phosphorylation: Pharmacological activation of AKT rescues mutant phenotypes, suggesting a downstream role in cytoskeletal regulation .

Disease Associations

DiseaseMechanismReferences
Leber Congenital Amaurosis (LCA16)Loss-of-function mutations impair K⁺ buffering in RPE, leading to photoreceptor death .
Snowflake Vitreoretinal Degeneration (SVD)Dominant-negative mutations cause channel dysfunction and retinal degeneration .
Smooth Muscle DisordersDefective ion homeostasis disrupts tracheal and esophageal tissue architecture .

Therapeutic Developments

  • Base Editing: Non-viral base-editing corrects KCNJ13 mutations in retinal cells, preserving vision in preclinical models .

  • Gene Therapy: Lentivirus-mediated KCNJ13 replacement partially restores retinal function in knockout mice .

  • Pharmacological Rescue: Readthrough inducers and gene augmentation strategies are under investigation for nonsense mutations .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
KCNJ13; Inward rectifier potassium channel 13; Inward rectifier K(+ channel Kir7.1; Potassium channel, inwardly rectifying subfamily J member 13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-360
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
KCNJ13
Target Protein Sequence
MDSSNCKVIAPLLSQRYRRMVTKDGHSTLQMDGAQRGLAYLRDAWGILMDMRWRWMMLVF SASFVVHWLVFAVLWYVLAEMNGDLELDHDAPPENHTICVKYITSFTAAFSFSLETQLTI GYGTMFPSGDCPSAIALLAIQMLLGLMLEAFITGAFVAKIARPKNRAFSIRFTDTAVVAH MDGKPNLIFQVANTRPSPLTSVRVSAVLYQERENGKLYQTSVDFHLDGISSDECPFFIFP LTYYHSITPSSPLATLLQHENPSHFELVVFLSAMQEGTGEICQRRTSYLPSEIMLHHCFA SLLTRGSKGEYQIKMENFDKTVPEFPTPLVSKSPNRTDLDIHINGQSIDNFQISETGLTE
Uniprot No.

Target Background

Function

Inward rectifier potassium channels (Kir) are characterized by their preference for potassium influx over efflux. Their voltage dependence is modulated by extracellular potassium concentration; increased external potassium shifts the channel activation voltage to more positive potentials. Inward rectification primarily results from intracellular magnesium block of outward current. KCNJ13 exhibits low single-channel conductance, minimal sensitivity to external barium and cesium block, and magnesium-independent inward rectification.

Gene References Into Functions

KCNJ13 (Kir7.1) Function and Associated Research:

  • MC4R-Kir7.1 signaling is independent of the Gs-AC-cAMP pathway, suggesting a noncanonical GPCR signaling mechanism. PMID: 29058194
  • Oxytocin receptor activation inhibits Kir7.1, influencing subretinal waste transport and potassium homeostasis. PMID: 28603013
  • KCNJ13 mutations cause early-onset retinal dystrophy, marked by retinal pigment epithelium dysfunction. PMID: 27203561
  • Kir7.1 mutations are linked to vision disorders, providing insights into Leber Congenital Amaurosis pathogenesis. PMID: 25921210
  • Recessive KCNJ13 mutations are associated with juvenile-onset cataracts and vitreoretinal dystrophy. PMID: 25475713
  • Kir7.1 regulates uterine transition from quiescence to contraction during pregnancy. PMID: 25056913
  • The R162W Kir7.1 mutant shows reduced current and a positive shift in the current potential. PMID: 23977131
  • Kir7.1 is expressed in choroid plexus tumors but absent in endolymphatic sac tumors. PMID: 22706862
  • A homozygous nonsense mutation in KCNJ13 causes Leber congenital amaurosis. PMID: 21763485
  • Kir7.1 is expressed in human RPE; a splice variant with altered protein sequence has been identified, and no functional interaction exists between this variant and full-length Kir7.1. PMID: 18035352
  • Kir7.1 function is dually regulated by PKA and PKC. PMID: 18976636
  • Intracellular protons modulate Kir7.1 channel function through multiple mechanisms; H26 is crucial for activation at physiological pH(i) and influences an inhibitory proton-induced mechanism. PMID: 18094146
  • The KCNJ13 R162W mutation causes Snowflake vitreoretinal degeneration, highlighting that vitreoretinal degeneration can result from mutations in non-structural vitreous components. PMID: 18179896
Database Links

HGNC: 6259

OMIM: 193230

KEGG: hsa:3769

STRING: 9606.ENSP00000233826

UniGene: Hs.467338

Involvement In Disease
Snowflake vitreoretinal degeneration (SVD); Leber congenital amaurosis 16 (LCA16)
Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ13 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Predominantly expressed in small intestine. Expression is also detected in stomach, kidney, and all central nervous system regions tested with the exception of spinal cord.

Q&A

What is the molecular structure of KCNJ13 and how does it function in cellular homeostasis?

KCNJ13 encodes Kir7.1, a member of the inward-rectifier potassium channel family. This channel contains two transmembrane domains with intracellular N and C termini, forming a tetrameric structure when assembled. Kir7.1 primarily functions by allowing greater potassium influx than efflux, contributing to the maintenance of resting membrane potential in various cell types. In the retinal pigment epithelium (RPE), KCNJ13 is critical for maintaining ion homeostasis across cell membranes, which directly impacts the structural integrity and functional capacity of these cells. Unlike some related channels (e.g., KCNJ11), KCNJ13 is not regulated by ATP but instead responds to membrane potential and extracellular potassium concentrations .

What are the primary model systems for studying KCNJ13 function?

Several model systems have proven valuable for KCNJ13 research:

Model SystemAdvantagesKey ApplicationsCitations
hiPSC-RPE cellsHuman relevance, disease modelingPhagocytosis studies, LCA16 modeling
Zebrafish (D. rerio)Visually trackable phenotypes, genetic manipulationPigmentation studies, evolutionary research
CRISPR/Cas9 knockout linesClean genetic background, precise gene editingFunctional characterization
Mouse modelsMammalian physiology, conditional knockoutsRetinal function studies

Human iPSC-derived RPE cells provide an excellent platform for studying KCNJ13's role in human retinal diseases, while zebrafish models offer advantages for understanding its evolutionary roles in pigmentation. CRISPR/Cas9 technology has been successfully employed to generate KCNJ13 knockouts in both systems, allowing for detailed functional characterization .

What are the optimal approaches for generating and validating KCNJ13 knockout models?

When designing CRISPR/Cas9-mediated KCNJ13 knockout experiments, researchers should:

How can researchers effectively measure KCNJ13-dependent phagocytic activity in RPE cells?

Quantitative assessment of KCNJ13's impact on phagocytosis can be performed through:

  • Preparation of fluorescently labeled porcine photoreceptor outer segments (POS) as standardized phagocytic particles.

  • Controlled exposure of wild-type and KCNJ13-KO RPE cells to labeled POS under identical conditions.

  • Quantification of uptake using fluorescence microscopy with automated image analysis or flow cytometry.

  • Complementary assessment of phagocytosis-related gene expression through quantitative PCR to correlate functional changes with molecular alterations .

Studies have demonstrated that KCNJ13-null hiPSC-RPE cells exhibit significantly reduced phagocytic activity compared to wild-type cells, suggesting a critical role for this channel in the phagocytic process essential for photoreceptor maintenance .

How does KCNJ13 regulate cell shape and intercellular interactions in different cell types?

KCNJ13 plays a crucial role in mediating cell shape and cell-cell interactions, particularly in pigment cells:

Methods to study these interactions include fluorescence imaging of labeled pigment cells, cell lineage tracing of marked clones, and creating genetic chimeras through transplantation experiments .

What methodological approaches can assess KCNJ13's role in membrane potential regulation during cell-cell contact?

Research has established that KCNJ13 function is required for the depolarization of melanophore membranes upon contact with xanthophores, a process potentially underlying repulsive interactions during pattern establishment . To investigate this mechanism:

  • Implement patch-clamp electrophysiology to measure membrane potential changes in real-time during controlled cell-cell contacts.

  • Utilize fluorescent voltage-sensitive dyes to visualize membrane potential dynamics in intact tissues.

  • Create co-culture systems with fluorescently labeled cell populations to correlate physical interactions with electrophysiological changes.

  • Apply pharmacological modulators of potassium channels to test the specificity of KCNJ13-mediated effects.

  • Generate cell type-specific reporter systems to monitor KCNJ13 expression during critical periods of pattern formation .

How has KCNJ13 function diverged across species and what mechanisms underlie this evolution?

The evolutionary divergence of KCNJ13 presents a fascinating area of research:

  • In the Danio genus, KCNJ13 has diverged functionally between species with different pigmentation patterns (horizontal stripes in D. rerio versus vertical bars in D. aesculapii) .

  • Transgenic rescue experiments have demonstrated that the protein-coding sequences from both species are functionally equivalent, indicating that protein structure is highly conserved .

  • Expression studies in hybrids revealed significantly higher expression of the D. rerio allele compared to the D. aesculapii allele, providing strong evidence that regulatory rather than protein-coding changes underlie evolutionary divergence .

  • Hybrids between D. rerio KCNJ13 mutants and seven additional Danio species suggest independent evolution of KCNJ13 function multiple times within the genus .

This research highlights how quantitative changes in gene expression, rather than alterations to protein structure, can drive pattern diversification across species.

What techniques can elucidate the cis-regulatory mechanisms controlling KCNJ13 expression?

To investigate cis-regulatory control of KCNJ13:

  • Generate reporter constructs containing promoter and enhancer regions from different species to identify regulatory elements driving expression differences.

  • Implement CRISPR/Cas9-mediated homology-directed repair to produce knock-in reporter lines, as demonstrated in D. rerio, which successfully recapitulated endogenous expression patterns in the pronephros, hindbrain, and melanophores .

  • Compare expression patterns across developmental stages to identify temporal regulation - for instance, KCNJ13 expression in D. rerio appears in patches of cells in the spinal cord during metamorphosis but is detected in only a few xanthophores and melanized melanophores in the skin during pattern formation .

  • Analyze sequence conservation in non-coding regions across species to identify potential regulatory elements under evolutionary selection.

What is the pathogenic mechanism linking KCNJ13 dysfunction to Leber congenital amaurosis type 16 (LCA16)?

The connection between KCNJ13 mutations and LCA16 involves several cellular mechanisms:

  • KCNJ13 deletion in hiPSC-RPE cells significantly reduces phagocytic activity, a critical function for photoreceptor outer segment renewal .

  • Expression of phagocytosis-related genes is altered in KCNJ13-null RPE cells, suggesting effects on multiple components of the phagocytic machinery .

  • Conditional knockout and genetic mosaic knockout mouse models of KCNJ13 demonstrate photoreceptor loss and abnormal electroretinogram (ERG) changes, confirming the essential role of this channel in maintaining retinal integrity .

  • Cell alignment defects in KCNJ13-deficient RPE may compromise the blood-retina barrier function, contributing to photoreceptor degeneration through disrupted homeostasis .

This multifaceted impact on RPE function explains how KCNJ13 mutations lead to the severe retinal phenotypes observed in LCA16 patients.

How can CRISPR/Cas9-engineered KCNJ13 models contribute to therapeutic development for retinal diseases?

CRISPR/Cas9-engineered models of KCNJ13 dysfunction offer valuable platforms for therapeutic development:

  • KCNJ13-KO hiPSC-RPE cells provide a human-relevant system for high-throughput screening of compounds that might restore or bypass defective phagocytic function .

  • The ability to generate isogenic control and mutant lines eliminates confounding genetic background effects, allowing precise assessment of therapeutic efficacy.

  • CRISPR-engineered zebrafish models enable in vivo evaluation of treatment effects on both cell morphology and tissue-level organization .

  • Conditional and tissue-specific knockout systems can help distinguish between developmental and maintenance roles of KCNJ13, informing optimal therapeutic windows.

  • Gene replacement strategies using modified CRISPR systems (base editing, prime editing) could be tested in these models to evaluate potential gene therapy approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.