Recombinant Human Inward rectifier potassium channel 4 (KCNJ4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize development according to your specification.
Synonyms
KCNJ4; IRK3; Inward rectifier potassium channel 4; HIRK2; HRK1; Hippocampal inward rectifier; HIR; Inward rectifier K(+ channel Kir2.3; IRK-3; Potassium channel, inwardly rectifying subfamily J member 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-445
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
KCNJ4
Target Protein Sequence
MHGHSRNGQAHVPRRKRRNRFVKKNGQCNVYFANLSNKSQRYMADIFTTCVDTRWRYMLM IFSAAFLVSWLFFGLLFWCIAFFHGDLEASPGVPAAGGPAAGGGGAAPVAPKPCIMHVNG FLGAFLFSVETQTTIGYGFRCVTEECPLAVIAVVVQSIVGCVIDSFMIGTIMAKMARPKK RAQTLLFSHHAVISVRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPYMTQEGEYLPLDQR DLNVGYDIGLDRIFLVSPIIIVHEIDEDSPLYGMGKEELESEDFEIVVILEGMVEATAMT TQARSSYLASEILWGHRFEPVVFEEKSHYKVDYSRFHKTYEVAGTPCCSARELQESKITV LPAPPPPPSAFCYENELALMSQEEEEMEEEAAAAAAVAAGLGLEAGSKEEAGIIRMLEFG SHLDLERMQASLPLDNISYRRESAI
Uniprot No.

Target Background

Function

Inward rectifier potassium channels (Kir) are characterized by their preferential inward potassium flux. Their voltage dependence is modulated by extracellular potassium concentration; increasing external potassium shifts the channel activation range to more positive voltages. Inward rectification primarily results from intracellular magnesium block. These channels are susceptible to blockade by extracellular barium and cesium.

Gene References Into Functions
  1. Downregulation of Kir2.1/2.3 inward rectifier potassium channels is associated with increased excitability and reduced dendritic arborization. PMID: 22396414
  2. Kir2.3 undergoes internalization via an AP-2 clathrin-dependent mechanism. PMID: 18180291
  3. Potential intramolecular interactions exist between Kir2.3(H117) and conserved cysteines near the selectivity filter. PMID: 18453743
  4. Kir2.3 plays a significant role in I(K1) currents within neonatal rat cardiomyocytes. PMID: 18503768
  5. TIP-1 may regulate the endocytic pathway of Kir2.3. PMID: 19635485
Database Links

HGNC: 6265

OMIM: 600504

KEGG: hsa:3761

STRING: 9606.ENSP00000306497

UniGene: Hs.32505

Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ4 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane.
Tissue Specificity
Heart, skeletal muscle, and several different brain regions including the hippocampus.

Q&A

What expression systems have proven effective for producing recombinant KCNJ4, and what are their respective advantages?

Multiple expression systems have been utilized for KCNJ4 and related Kir channels, with Saccharomyces cerevisiae emerging as particularly effective. The yeast system has successfully expressed 10 of 11 human KCNJ channels tested, including KCNJ4 .

Advantages of the S. cerevisiae expression system include:

  • Proper trafficking of KCNJ channels to the plasma membrane, which indicates correct folding and functionality

  • Capability for a 2-step purification process that yields >95% purity in a mono-dispersed form

  • The purified channels can be successfully incorporated into liposomes and maintain functionality as confirmed by 86Rb+ flux assays

  • The system provides sufficient material for detailed biochemical and structural analysis

While mammalian cell lines (like HEK293) are commonly used for electrophysiological studies, the yeast system offers better scalability for protein production. The methodological approach typically involves:

  • Creating GFP-fusion constructs to monitor protein expression and localization

  • Implementing a multi-step purification process

  • Reconstituting purified channels into proteoliposomes

  • Validating functionality through ion flux assays

Researchers should note that expression levels vary between different channel isoforms, possibly due to differences in codon usage, mRNA stability, membrane insertion energetics, or requirements for specific chaperones or binding partners .

What are the tissue distribution patterns of KCNJ4 and their physiological significance?

KCNJ4 shows a distinct tissue distribution pattern with predominantly high expression in both heart and brain tissues. Specifically:

  • Cardiac Distribution: KCNJ4 is expressed in cardiac myocytes and contributes to the cardiac classical inward rectifier potassium currents (IK1) in neonatal rat cardiomyocytes .

  • Neurological Distribution: KCNJ4 is especially prevalent in the forebrain region and is mainly localized at the postsynaptic membrane of excitatory synapses .

  • Gastrointestinal System: KCNJ4 (Kir2.3) has been identified in interstitial cells of Cajal (ICC) from murine colonic muscles, where it functions alongside other Kir channels (Kir2.1, Kir2.4, Kir3.4, Kir6.1, and Kir6.2) .

The physiological significance of this distribution relates to KCNJ4's fundamental roles:

  • Regulation of resting membrane potential

  • Control of cellular excitability

  • Maintenance of potassium homeostasis in the nervous system and various peripheral tissues

In colonic ICC, Kir2 antagonists cause depolarization of freshly dispersed ICC and colonic smooth muscles, suggesting that this conductance is active under resting conditions and contributes to baseline membrane potential regulation .

The differential expression of KCNJ4 in various disease states provides further insights into its physiological importance:

ConditionKCNJ4 Expression ChangeReference
Heart Failure (HF)Increased (↗)
Atrial Fibrillation (AF)Increased (↗)

These expression changes suggest potential roles in cardiac pathophysiology, making KCNJ4 an important target for research into cardiac electrical dysfunction.

What are the optimal experimental design considerations when investigating KCNJ4 channel function in heterologous expression systems?

When investigating KCNJ4 channel function in heterologous systems, researchers should consider several critical experimental design factors:

  • Expression System Selection: While S. cerevisiae has proven successful for protein production , patch-clamp electrophysiology often benefits from mammalian cell systems. The choice depends on your specific research questions:

    • For structural studies: S. cerevisiae offers higher yield and purity

    • For functional characterization: HEK293 or CHO cells may provide more native-like membrane composition

  • Channel Modulators: KCNJ4 activity is highly dependent on phosphatidylinositol 4,5-bisphosphate (PIP(4,5)2). In the absence of PIP(4,5)2, KCNJ channels show minimal activity, consistent with observed rundown of IRK currents in heterologous systems . Experimental designs should include:

    • Control conditions with and without 0.1% PIP(4,5)2

    • Polyamine tests (e.g., 1μM spermine) as blockers to confirm specific Kir current

  • Voltage Protocols: Given the inward rectification properties of KCNJ4:

    • Use ramp depolarizations from -140mV to +40mV to measure reversal potentials

    • Hold cells at -80mV when measuring responses to K+ concentration changes

    • Test multiple external K+ concentrations to verify Nernstian behavior

  • Avoiding Batch Effects: As highlighted in source , poor randomization in experimental design is the number one problem encountered in genetic studies, leading to spurious associations. To minimize these effects:

    • Randomize sample plating with respect to experimental conditions

    • Include positive controls (e.g., known KCNJ family members)

    • Perform experiments on multiple days with freshly transfected cells

    • Consider blind analysis of electrophysiological data

  • Confirmation of Channel Identity:

    • Pharmacological profile testing with Ba2+ (10μM) and ML-133 (10μM), known Kir2 inhibitors

    • Verification of biophysical properties including inward rectification and K+ selectivity

These considerations help ensure reproducible and physiologically relevant experimental outcomes when studying KCNJ4 channel properties.

How do disease-associated changes in KCNJ4 expression affect cardiac electrophysiology, and what methodologies best detect these alterations?

Recent meta-analyses of mechano-sensitive ion channels in human hearts have revealed significant alterations in KCNJ4 expression in cardiac pathologies. These changes have important implications for cardiac electrophysiology and require specific methodological approaches for proper characterization.

Disease-Associated Expression Changes:

ConditionKCNJ4 Expression ChangeMagnitudeOther Affected MSCsReference
Heart Failure (HF) vs. DonorIncreased (↗)<1 order of magnitudeCHRNE↗, TRPC6↗, SCN9A↘, CFTR↘, ASIC3↘, LRRC8A↘, KCNJ11↘, TMEM63A↘
Atrial Fibrillation (AF) vs. Sinus Rhythm (SR)Increased (↗)<1 order of magnitudePKD1↗, KCNQ4↗, KCNQ5↘, TMC5↘, KCNJ5↘

Functional Consequences:

Increased KCNJ4 expression in heart failure and atrial fibrillation suggests altered inward rectifier current density, which would affect:

  • Resting membrane potential stabilization

  • Action potential duration and morphology

  • Cellular excitability thresholds

  • Susceptibility to triggered activity

Optimal Methodological Approaches:

To accurately characterize these disease-associated changes, researchers should consider:

  • Transcriptomic Analysis:

    • RNA-seq or qPCR analysis of cardiac tissue samples

    • Single-cell transcriptomics to identify cell-specific expression patterns

    • Validation through multiple reference genes given the relatively modest expression changes

  • Protein Expression Verification:

    • Western blot with isoform-specific antibodies

    • Immunohistochemistry to determine spatial distribution changes

    • Mass spectrometry for unbiased protein quantification

  • Functional Assessment:

    • Patch-clamp electrophysiology with specific Kir2.3 protocols

    • Comparison of native cardiomyocyte currents between healthy and diseased samples

    • Action potential recordings to evaluate integrated effects

  • Computational Modeling:

    • Integration of measured KCNJ4 expression changes into cardiac action potential models

    • Prediction of resultant electrophysiological alterations

    • Simulation of arrhythmogenic potential

  • Genetic Approaches:

    • CRISPR-based modulation of KCNJ4 expression to mimic disease states

    • Correlation of genetic variants with expression levels

    • Assessment of compensatory changes in other Kir family members

Given that KCNJ4 expression changes are relatively modest (<1 order of magnitude), highly sensitive and well-controlled experimental approaches are essential to accurately characterize the functional consequences of these alterations.

What interactome profiles have been established for KCNJ4, and how do they compare with other Kir2 family members?

While a comprehensive interactome specifically for KCNJ4 has not been fully established in the provided search results, we can extrapolate meaningful insights from studies of related Kir2 family members, particularly Kir2.1 (KCNJ2).

Kir2.1 Interactome as a Model:

A proximity-labeling approach (BioID) identified 218 high-confidence interactions for Kir2.1 channels . This interactome encompasses various molecular mechanisms including:

  • Intracellular trafficking pathways

  • Cross-talk with insulin-like growth factor receptor signaling

  • Lysosomal degradation processes

These findings likely have relevance to KCNJ4 (Kir2.3) given the structural and functional similarity within the Kir2 subfamily.

Key Validated Interactions:

PKP4 (Plakophilin-4) was identified and validated as a functional interactor of Kir2.1, modulating the Kir2.1-regulated inward rectifier potassium currents . This suggests that:

  • Scaffolding proteins play important roles in Kir channel function

  • Protein-protein interactions can directly modulate channel activity

  • The interactome extends beyond direct channel modulators to include regulatory proteins

Methodological Approaches for KCNJ4 Interactome Mapping:

To establish a KCNJ4-specific interactome, researchers should consider:

  • Proximity-Based Labeling Techniques:

    • BioID or TurboID fusion constructs with KCNJ4

    • APEX2-based proximity labeling

    • Time-resolved interactome mapping during trafficking and membrane insertion

  • Co-Immunoprecipitation Studies:

    • Using tagged KCNJ4 constructs in heterologous expression systems

    • Pull-down experiments from native tissues with high KCNJ4 expression

    • Comparison across different tissue types (cardiac vs. neuronal)

  • Comparative Analysis:

    • Systematic comparison with Kir2.1 (KCNJ2) interactome

    • Identification of subfamily-specific vs. isoform-specific interactions

    • Analysis of disease state-specific interactome changes

  • Functional Validation:

    • Electrophysiological assessment of identified interactors

    • Mutation of key interaction domains to verify functional relevance

    • Co-expression studies in heterologous systems

Understanding the KCNJ4 interactome would provide valuable insights into its regulation and could help identify novel therapeutic targets for conditions with altered KCNJ4 expression or function.

What epigenetic regulatory mechanisms control KCNJ4 expression, and how can these be experimentally manipulated?

Emerging evidence suggests epigenetic mechanisms play important roles in regulating KCNJ4 expression. Limited data from the search results indicates DNA methylation as one such regulatory mechanism.

DNA Methylation Regulation:

Pyrosequencing evidence shows that KCNJ4 contains CpG sites that can be hypermethylated in response to resveratrol (RSV) exposure, with increases in methylation ranging from 7-16% . This suggests:

  • KCNJ4 expression may be sensitive to environmental factors through epigenetic mechanisms

  • Stilbenoids like resveratrol may modulate KCNJ4 through methylation changes

  • The epigenetic regulation of KCNJ4 could be tissue-specific

Experimental Approaches to Study Epigenetic Regulation:

To investigate and manipulate epigenetic regulation of KCNJ4, researchers should consider:

  • Methylation Analysis Techniques:

    • Illumina 450K/EPIC microarrays for genome-wide methylation profiling

    • Bisulfite pyrosequencing for targeted validation of specific CpG sites

    • Whole genome bisulfite sequencing for comprehensive methylation landscape

  • Chromatin Structure Analysis:

    • ChIP-seq for histone modification patterns at the KCNJ4 locus

    • ATAC-seq to assess chromatin accessibility

    • HiC or related techniques to evaluate 3D chromatin organization affecting KCNJ4

  • Experimental Manipulation:

    • DNMT inhibitors (5-azacytidine, decitabine) to reduce DNA methylation

    • HDAC inhibitors to modify histone acetylation patterns

    • CRISPR-based epigenetic editors for site-specific modification

    • Dietary interventions with bioactive compounds like resveratrol

  • Correlation with Expression:

    • qPCR and RNA-seq to correlate methylation changes with expression levels

    • Single-cell approaches to address cellular heterogeneity

    • Temporal analysis to establish causality rather than correlation

  • Disease-Specific Patterns:

    • Comparison of methylation patterns between normal and pathological states

    • Analysis of heart failure and atrial fibrillation samples with known KCNJ4 expression changes

A targeted experimental design might include:

  • Treatment of cardiac or neuronal cells with epigenetic modifiers

  • Measurement of KCNJ4 expression changes by qPCR and Western blot

  • Correlation with methylation status at specific CpG sites

  • Functional assessment through patch-clamp electrophysiology

This approach would help establish mechanistic links between epigenetic regulation and KCNJ4 function in both physiological and pathological contexts.

How do researchers address the contradictory findings regarding KCNJ4 function in different experimental systems and disease models?

Contradictory findings regarding KCNJ4 function across different experimental systems and disease models present significant challenges for researchers. Several methodological approaches can help address and reconcile these contradictions:

Sources of Experimental Contradictions:

  • Expression System Variations:

    • Different heterologous systems may produce varying results due to diverse membrane compositions and accessory protein availability

    • Native tissue studies may reflect complex regulatory mechanisms absent in simplified systems

  • Experimental Design Issues:

    • Batch effects and poor randomization create spurious associations that can lead to contradictory findings

    • Lack of standardized protocols for channel characterization

  • Disease Model Complexity:

    • KCNJ4 expression is increased in both heart failure and atrial fibrillation , but the functional consequences may differ

    • Potential compensatory mechanisms by other Kir channels may mask KCNJ4-specific effects

Strategies to Address Contradictions:

  • Systematic Experimental Design:

    • Implement rigorous randomization protocols to minimize batch effects

    • Use consistent positive and negative controls across experiments

    • Design experiments that account for potential confounding variables

  • Multi-System Validation:

    • Compare results across multiple expression systems (yeast, mammalian cells, primary cultures)

    • Validate findings in native tissues when possible

    • Use complementary methodologies (electrophysiology, biochemistry, imaging)

  • Meta-Analysis Approaches:

    • Systematic review of existing literature with standardized quality assessment

    • Statistical pooling of results where methodologically sound

    • Identification of moderator variables that may explain contradictions

  • Context-Specific Characterization:

    • Characterize KCNJ4 function under specific conditions that reflect physiological contexts

    • Account for heteromerization with other Kir subunits

    • Consider cell-type specific regulation and expression patterns

  • Advanced Statistical Methods:

    • Implement multiple comparison corrections

    • Use Bayesian approaches to incorporate prior knowledge

    • Employ sensitivity analyses to test the robustness of findings

Case Example: Reconciling KCNJ4 Functional Discrepancies

Contradictory findings regarding KCNJ4 function in cardiac tissues could be addressed by:

  • Precise tissue microdissection to isolate specific cardiac regions

  • Single-cell electrophysiology with molecular identification of recorded cells

  • Comparison of heterologously expressed KCNJ4 with native currents

  • Analysis of subunit composition through co-immunoprecipitation

  • Computational modeling to integrate diverse experimental datasets

By employing these rigorous approaches, researchers can more confidently distinguish genuine biological variability from experimental artifacts in KCNJ4 functional studies.

What are the optimal purification protocols for obtaining functional recombinant KCNJ4 suitable for structural and biochemical studies?

Obtaining pure, functional recombinant KCNJ4 for structural and biochemical studies requires a carefully optimized purification protocol. Based on successful approaches with KCNJ family members, the following methodology is recommended:

Expression System Selection:

The eukaryotic budding yeast Saccharomyces cerevisiae has proven effective for expressing 10 of 11 KCNJ channels tested, suggesting it would be suitable for KCNJ4 production . The yeast system provides:

  • Correct trafficking to the plasma membrane

  • Protein production sufficient for biochemical and structural studies

  • Post-translational modifications more similar to human cells than bacterial systems

Purification Protocol:

A 2-step purification process can yield >95% pure KCNJ4 in a mono-dispersed form :

  • Initial Preparation:

    • Transform yeast with KCNJ4 expression constructs

    • Culture in selective media to mid-log phase

    • Harvest cells and prepare membrane fractions

  • Solubilization:

    • Solubilize membranes using mild detergents (e.g., DDM, LMNG)

    • Optimize detergent:protein ratio to maintain tetrameric structure

    • Centrifuge to remove insoluble material

  • Affinity Purification:

    • Pass solubilized material through an affinity column

    • For His-tagged constructs, use Ni-NTA resin

    • Wash extensively to remove non-specific binding

    • Elute with imidazole gradient

  • Size Exclusion Chromatography:

    • Further purify eluted protein by size exclusion chromatography

    • Select fractions containing tetrameric KCNJ4

    • Verify mono-dispersity and tetrameric state

Quality Control Assessments:

  • Purity Assessment:

    • SDS-PAGE with silver staining

    • Western blot with KCNJ4-specific antibodies

    • Mass spectrometry for contaminant identification

  • Structural Integrity:

    • Circular dichroism to assess secondary structure

    • Thermal stability assays

    • Native PAGE to confirm tetrameric assembly

  • Functional Validation:

    • Reconstitution into proteoliposomes

    • 86Rb+ flux assays in the presence of PIP(4,5)2

    • Inhibition with specific blockers (Ba2+, spermine)

Critical Considerations:

  • Lipid Environment:

    • Include key lipids (especially PIP(4,5)2) during purification and reconstitution

    • Consider nanodiscs for maintaining native-like lipid environment

  • Stability Optimization:

    • Screen various buffer compositions

    • Test stabilizing additives (glycerol, cholesterol)

    • Optimize temperature conditions

  • Construct Design:

    • Consider fusion tags that enhance expression and stability

    • Evaluate the impact of GFP or other tags on function

    • Test minimal constructs for structural studies

This methodological approach should produce high-quality KCNJ4 suitable for structural studies (X-ray crystallography, cryo-EM) and biochemical analyses (binding assays, interaction studies).

What electrophysiological protocols are most effective for characterizing KCNJ4 channel kinetics and pharmacology?

Effective characterization of KCNJ4 channel kinetics and pharmacology requires specialized electrophysiological protocols that address the unique properties of inwardly rectifying potassium channels. The following methodological approach is recommended based on successful investigations of Kir channels:

Whole-Cell Patch Clamp Protocols:

  • Basic Characterization:

    • Hold cells at -80 mV, which is near the K+ equilibrium potential under physiological conditions

    • Apply voltage ramps from -140 mV to +40 mV to visualize the complete I-V relationship and inward rectification

    • Measure reversal potentials under different external K+ concentrations to confirm K+ selectivity

  • Rectification Analysis:

    • Calculate rectification index (RI) as the ratio of outward to inward current at equivalent voltage distances from reversal potential

    • Examine polyamine block by including different concentrations of spermine or spermidine in the intracellular solution

    • Test Mg2+ dependence of rectification

  • Pharmacological Characterization:

    • Apply Ba2+ (10 μM) and ML-133 (10 μM) as specific Kir2 inhibitors

    • Test pH sensitivity with buffers ranging from pH 6.0 to 8.0

    • Evaluate PIP(4,5)2 dependence by including different concentrations in the intracellular solution

Inside-Out Patch Protocols:

Inside-out patches are particularly valuable for studying KCNJ4 regulation:

  • PIP(4,5)2 Modulation:

    • After patch excision, apply different concentrations of PIP(4,5)2 (0.01-1%) to the cytoplasmic face

    • Monitor current recovery as a measure of PIP(4,5)2 sensitivity

    • Test PIP(4,5)2 analogues to determine structural requirements

  • Polyamine Sensitivity:

    • Construct dose-response curves for spermine and spermidine

    • Determine IC50 values at different membrane potentials

    • Compare blocking kinetics across different Kir2 family members

Data Analysis Approaches:

  • Kinetic Analysis:

    • Fit activation and deactivation time courses with appropriate mathematical functions

    • Analyze single-channel properties if attainable (conductance, open probability)

    • Use non-stationary noise analysis if single-channel recordings are challenging

  • Quantitative Pharmacology:

    • Construct dose-response curves for blockers

    • Apply the Hill equation to determine IC50 values and Hill coefficients

    • Analyze competitive vs. non-competitive inhibition

  • Biophysical Property Determination:

    • Calculate conductance-voltage relationships

    • Analyze K+ dependence of conductance

    • Determine temperature dependence (Q10)

Specialized Considerations for KCNJ4:

  • Heteromerization Effects:

    • Co-express KCNJ4 with other Kir2 family members to assess heteromeric channel properties

    • Compare homomeric vs. heteromeric channel pharmacology

    • Use concatenated constructs to control subunit stoichiometry

  • Modulation by Signaling Pathways:

    • Test effects of PKA and PKC activators/inhibitors

    • Examine modulation by tyrosine kinases

    • Evaluate G-protein dependent regulation

  • Disease-Relevant Conditions:

    • Simulate ischemic conditions (low pH, elevated K+)

    • Test antiarrhythmic drugs used in conditions with altered KCNJ4 expression

    • Examine temperature dependence relevant to febrile states

These comprehensive electrophysiological approaches will provide detailed insights into KCNJ4 channel properties, pharmacology, and potential therapeutic interventions targeting this channel.

What gene editing strategies have proven most effective for investigating KCNJ4 function in cellular and animal models?

While the search results don't provide specific information about gene editing of KCNJ4, we can synthesize methodological recommendations based on current best practices in ion channel research and the specific characteristics of KCNJ4.

CRISPR/Cas9-Based Approaches:

  • Complete Knockout Strategies:

    • Target early exons (KCNJ4 has 3 exons total) to ensure complete protein disruption

    • Design multiple guide RNAs targeting different regions to increase success rates

    • Verify knockout by sequencing, Western blot, and functional assays (patch-clamp)

  • Knock-in Approaches for Tagged Variants:

    • C-terminal tagging is preferable since N-terminal modifications may disrupt trafficking

    • Consider fluorescent protein tags (GFP, mCherry) for localization studies

    • Add epitope tags (HA, FLAG) for biochemical analyses and interactome mapping

  • Point Mutations:

    • Introduce disease-relevant mutations to study pathophysiological mechanisms

    • Target key residues involved in PIP(4,5)2 binding, polyamine block, or tetramerization

    • Use homology-directed repair with single-stranded oligodeoxynucleotide donors

Cellular Models:

  • iPSC-Derived Cardiomyocytes:

    • Generate KCNJ4 knockouts or mutations in human iPSCs

    • Differentiate into cardiomyocytes for functional studies

    • Perform multi-electrode array recordings to assess effects on cellular electrophysiology

  • Primary Neuronal Cultures:

    • Use in utero electroporation to deliver CRISPR components

    • Analyze effects on neuronal excitability and synaptic function

    • Combine with calcium imaging to assess network effects

  • Heterologous Expression Systems:

    • Create stable cell lines with inducible KCNJ4 expression

    • Generate dominant-negative mutants to study heteromeric channel assembly

    • Implement rescue experiments with wildtype and mutant constructs

Animal Models:

  • Mouse Models:

    • Generate constitutive or conditional Kcnj4 knockout mice

    • Create tissue-specific knockouts using Cre-loxP systems for cardiac or neuronal studies

    • Develop knock-in models with human disease-associated mutations

  • Zebrafish Models:

    • Use morpholinos or CRISPR to target kcnj4 homologs

    • Perform high-throughput phenotypic screening

    • Conduct in vivo cardiac imaging and electrophysiology

  • Temporal Control Strategies:

    • Implement inducible expression systems (Tet-On/Off)

    • Use optogenetic or chemogenetic approaches for acute modulation

    • Apply viral delivery of Cre recombinase to induce time-controlled knockout

Validation Strategies:

  • Molecular Validation:

    • Genomic DNA sequencing to confirm edits

    • RT-PCR and quantitative PCR for transcript analysis

    • Western blotting to verify protein expression changes

  • Functional Validation:

    • Patch-clamp electrophysiology to assess channel function

    • Current-clamp recordings to determine effects on excitability

    • In vivo ECG in animal models to assess cardiac phenotypes

  • Compensatory Mechanism Assessment:

    • RNA-seq to identify compensatory gene expression changes

    • Analysis of other Kir family members' expression

    • Pharmacological inhibition studies to determine functional compensation

These gene editing strategies provide a comprehensive toolkit for investigating KCNJ4 function across different experimental models, from basic cellular systems to complex in vivo studies.

How do alterations in KCNJ4 expression or function contribute to cardiac arrhythmias, and what therapeutic approaches might target these mechanisms?

KCNJ4 alterations appear to play significant roles in cardiac arrhythmias, with specific expression changes observed in major cardiac pathologies. Understanding these mechanisms offers insights into potential therapeutic strategies.

Expression Changes in Cardiac Pathologies:

  • Heart Failure (HF):

    • KCNJ4 expression is increased in HF compared to donor hearts

    • This alteration occurs alongside changes in other mechano-sensitive channels (CHRNE↑, TRPC6↑, SCN9A↓, CFTR↓, ASIC3↓, LRRC8A↓, KCNJ11↓, TMEM63A↓)

  • Atrial Fibrillation (AF):

    • KCNJ4 expression is higher in AF compared to patients in sinus rhythm (SR)

    • Concurrent changes occur in PKD1↑, KCNQ4↑, KCNQ5↓, TMC5↓, and KCNJ5↓

Pathophysiological Mechanisms:

Increased KCNJ4 expression in these conditions may contribute to arrhythmogenesis through:

  • Altered Resting Membrane Potential:

    • Enhanced inward rectifier current could hyperpolarize cardiomyocytes

    • Changes in RMP affect the threshold for action potential initiation

    • Altered excitability may promote reentry circuits

  • Action Potential Duration Modifications:

    • Increased repolarizing K+ currents could shorten action potential duration

    • Heterogeneous expression may increase repolarization dispersion

    • These changes create substrate for reentrant arrhythmias

  • Abnormal Automaticity:

    • Altered balance between depolarizing and repolarizing currents

    • Impact on pacemaker activity in specialized cardiac tissues

    • Potential for triggered activity

Therapeutic Approaches:

Several strategies could target KCNJ4-related mechanisms in cardiac arrhythmias:

  • Channel-Specific Pharmacology:

    • Develop selective KCNJ4 modulators with greater specificity than Ba2+ or ML-133

    • Design drugs that normalize, rather than completely block, channel function

    • Create state-dependent inhibitors that preferentially act under pathological conditions

  • Gene Therapy Approaches:

    • RNA interference targeting KCNJ4 in conditions with pathological overexpression

    • Delivery of dominant-negative constructs to reduce functional channel density

    • CRISPR-based approaches to normalize expression levels

  • Indirect Modulation:

    • Target PIP(4,5)2 metabolism to modify KCNJ4 activity

    • Modulate regulatory pathways that control channel trafficking or gating

    • Develop biologics targeting critical protein-protein interactions

  • Combination Therapies:

    • Address multiple ion channel alterations simultaneously

    • Target both KCNJ4 and interacting proteins

    • Personalize approaches based on patient-specific electrophysiological profiles

  • Biomarker Development:

    • Use KCNJ4 expression profiles as potential biomarkers for arrhythmia risk

    • Develop non-invasive methods to assess channel function

    • Create patient stratification tools for precision medicine approaches

By targeting the specific mechanisms by which KCNJ4 alterations contribute to cardiac arrhythmias, researchers may develop more effective and targeted therapeutic strategies with fewer side effects than traditional antiarrhythmic approaches.

What experimental evidence links KCNJ4 to neurological disorders, and how can researchers better characterize these associations?

While the search results don't provide direct evidence linking KCNJ4 to specific neurological disorders, we can extrapolate from its known neurological expression patterns and the established roles of Kir channels in neuronal function to propose methodological approaches for investigating such associations.

Neurological Expression and Function of KCNJ4:

KCNJ4 is predominantly expressed in the forebrain region and is mainly localized at the postsynaptic membrane of excitatory synapses . This specific localization suggests potential roles in:

  • Regulation of neuronal excitability

  • Modulation of synaptic transmission

  • Control of membrane potential in specific neuronal populations

Methodological Approaches to Characterize KCNJ4 in Neurological Disorders:

  • Expression Analysis in Disease Models:

    • Transcriptomic profiling of KCNJ4 in post-mortem brain tissue from neurological disorder patients

    • Single-cell RNA-seq to identify cell type-specific expression changes

    • Proteomic analysis to confirm translational alterations

    • Spatial transcriptomics to map regional expression patterns

  • Functional Characterization:

    • Patch-clamp electrophysiology in neurons derived from patient iPSCs

    • Multi-electrode array recordings to assess network activity

    • Optogenetic manipulation of KCNJ4-expressing neurons

    • In vivo electrophysiology in animal models with altered KCNJ4 expression

  • Genetic Association Studies:

    • Targeted sequencing of KCNJ4 in patient cohorts with specific neurological disorders

    • Analysis of common and rare variants in large-scale genomic databases

    • Functional characterization of identified variants

    • Creation of knock-in mouse models with human disease-associated variants

  • Circuit-Level Analysis:

    • Cell type-specific manipulation of KCNJ4 in defined neural circuits

    • Calcium imaging to assess circuit dynamics

    • Behavioral phenotyping of animal models

    • Correlation of electrophysiological alterations with behavioral phenotypes

  • Pharmacological Approaches:

    • Development of KCNJ4-specific modulators for experimental use

    • Testing effects in animal models of neurological disorders

    • Combined electrophysiology and pharmacology in ex vivo preparations

    • Screening for compounds that normalize aberrant KCNJ4 function

Potential Neurological Disorder Associations:

Based on the known functions of Kir channels, researchers should prioritize investigating KCNJ4 in:

  • Epilepsy and Seizure Disorders:

    • KCNJ4's role in regulating neuronal excitability makes it a candidate for epilepsy mechanisms

    • Analysis in animal models of seizure disorders

    • Targeted genetic screening in familial epilepsy cohorts

  • Neurodevelopmental Disorders:

    • Investigation of KCNJ4's developmental expression patterns

    • Analysis in autism spectrum disorder and intellectual disability cohorts

    • Characterization in models of abnormal brain development

  • Neuropsychiatric Conditions:

    • Studies in depression, schizophrenia, and bipolar disorder

    • Investigation of KCNJ4 modulation by psychotropic medications

    • Analysis of regulatory mechanisms in stress-response circuits

  • Neurodegenerative Diseases:

    • Examination of KCNJ4 alterations in Alzheimer's and Parkinson's disease

    • Investigation of potential neuroprotective roles

    • Analysis of interaction with disease-associated proteins

By implementing these rigorous methodological approaches, researchers can better characterize potential associations between KCNJ4 and neurological disorders, potentially identifying novel therapeutic targets and diagnostic biomarkers.

How are high-throughput screening approaches being adapted to identify novel modulators of KCNJ4 activity?

High-throughput screening (HTS) for KCNJ4 modulators presents unique challenges due to the channel's inward rectification properties and dependency on PIP(4,5)2. While specific information on KCNJ4 screening wasn't found in the search results, we can outline methodological approaches based on recent advances in ion channel drug discovery.

Assay Development for KCNJ4 Screening:

  • Fluorescence-Based Methods:

    • Membrane potential dyes (e.g., DiSBAC2(3), FluoVolt) to detect changes in resting potential

    • Thallium (Tl+) flux assays using FluxOR dye (Tl+ permeates K+ channels)

    • Development of specialized voltage protocols to maximize signal for inwardly rectifying channels

  • Electrophysiological Platforms:

    • Automated patch-clamp systems (IonWorks Barracuda, QPatch, SyncroPatch)

    • Optimization of voltage protocols specific for KCNJ4

    • Implementation of PIP(4,5)2 supplementation to maintain channel activity

  • Yeast-Based Screening:

    • Adaptation of the S. cerevisiae expression system for growth-based screens

    • Development of reporter systems linked to K+ flux

    • Selection strategies based on K+ dependency or toxin resistance

  • Label-Free Technologies:

    • Surface plasmon resonance to detect direct binding to purified KCNJ4

    • Cellular impedance measurements to detect changes in cell morphology or adhesion

    • Thermal shift assays to identify stabilizing compounds

Innovative Screening Strategies:

  • Fragment-Based Approaches:

    • Screening smaller "fragment" compounds (<300 Da)

    • NMR or X-ray crystallography to confirm binding

    • Fragment evolution to develop high-affinity modulators

  • Virtual Screening:

    • Homology modeling of KCNJ4 based on available Kir structure

    • Molecular docking of virtual compound libraries

    • Molecular dynamics simulations to identify allosteric binding sites

  • Phenotypic Screening:

    • Multiparametric analysis in cellular disease models

    • High-content imaging to detect changes in channel trafficking

    • Machine learning to identify complex phenotypic signatures

  • DNA-Encoded Libraries:

    • Screening billions of compounds simultaneously

    • Affinity selection against immobilized KCNJ4

    • Sequencing-based deconvolution of hits

Validation and Characterization Pipeline:

  • Primary Hit Confirmation:

    • Dose-response analysis in primary screening assay

    • Counter-screening against related channels for selectivity

    • Elimination of false positives through orthogonal assays

  • Mechanistic Characterization:

    • Manual patch-clamp to determine precise effects on channel kinetics

    • Competition studies with known KCNJ4 modulators

    • Investigation of PIP(4,5)2 dependency

  • Structure-Activity Relationship Analysis:

    • Medicinal chemistry optimization

    • Computational modeling of binding interactions

    • Development of photoaffinity probes to identify binding sites

  • Physiological Relevance Testing:

    • Evaluation in native tissues expressing KCNJ4

    • Assessment in disease-relevant cellular models

    • In vivo testing in appropriate animal models

These methodological approaches provide a framework for identifying novel KCNJ4 modulators with potential therapeutic applications in cardiac arrhythmias and other conditions associated with altered KCNJ4 function.

How might systems biology approaches integrate KCNJ4 function into broader regulatory networks in cardiac and neuronal systems?

Systems biology offers powerful frameworks to integrate KCNJ4 function within complex regulatory networks, providing deeper insights into both physiological roles and pathological contributions. Though not explicitly detailed in the search results, we can propose methodological approaches based on current systems biology paradigms.

Multi-Omics Data Integration:

  • Transcriptomic Approaches:

    • RNA-seq to identify co-regulated gene networks with KCNJ4

    • Single-cell transcriptomics to map cell type-specific expression patterns

    • Time-course analysis during development or disease progression

    • Correlation of KCNJ4 expression with other ion channels and regulators

  • Proteomic Integration:

    • Interactome mapping using proximity labeling approaches (similar to the BioID approach used for Kir2.1)

    • Phosphoproteomics to identify post-translational modifications

    • Spatial proteomics to determine subcellular localization patterns

    • Correlation of protein expression with functional data

  • Metabolomic Connections:

    • Analysis of metabolites affecting KCNJ4 function

    • Investigation of PIP(4,5)2 metabolism in relation to channel activity

    • Identification of metabolic signatures associated with altered KCNJ4 function

Computational Modeling Approaches:

  • Multi-Scale Modeling:

    • Molecular models of KCNJ4 structure and gating

    • Cell-level models incorporating KCNJ4 into action potential dynamics

    • Tissue-level models to assess propagation and arrhythmia susceptibility

    • Organ-level simulations to predict integrated physiological effects

  • Network Analysis:

    • Construction of protein-protein interaction networks centered on KCNJ4

    • Identification of hub proteins and potential regulatory nodes

    • Perturbation analysis to predict system responses to KCNJ4 modulation

    • Comparison of network topology between healthy and disease states

  • Machine Learning Integration:

    • Pattern recognition in multi-omics datasets to identify KCNJ4-associated signatures

    • Predictive modeling of drug responses based on KCNJ4 network status

    • Feature extraction to identify critical determinants of KCNJ4 function

Experimental Validation Strategies:

  • Targeted Perturbation Experiments:

    • CRISPR interference/activation to modulate KCNJ4 and predicted network components

    • Combinatorial perturbations to test predicted interactions

    • Optogenetic or chemogenetic approaches for temporal control

    • Validation of computational model predictions

  • Physiological Context Assessment:

    • Multi-electrode array recordings to assess network-level effects

    • Optical mapping in cardiac tissue to visualize propagation patterns

    • In vivo measurements correlated with computational predictions

    • Disease model validation of network predictions

  • Therapeutic Target Identification:

    • Network analysis to identify druggable nodes affecting KCNJ4 function

    • Prediction of combination therapies with synergistic effects

    • Simulation of off-target effects and compensatory mechanisms

    • Patient-specific modeling for precision medicine approaches

Application Examples:

  • Cardiac Systems:

    • Integration of KCNJ4 with other ion channels involved in atrial fibrillation

    • Modeling compensatory changes in heart failure with elevated KCNJ4 expression

    • Simulation of drug effects on complex cardiac electrophysiology

    • Prediction of arrhythmia vulnerability based on KCNJ4 network status

  • Neuronal Systems:

    • Integration of KCNJ4 into synaptic plasticity networks

    • Modeling effects on network excitability and oscillatory patterns

    • Prediction of seizure susceptibility based on KCNJ4 regulatory status

    • Identification of potential neurodevelopmental roles

These systems biology approaches can transform our understanding of KCNJ4 from a single channel perspective to an integrated component of complex physiological systems, potentially revealing novel therapeutic targets and diagnostic approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.