Recombinant Human Kappa-type opioid receptor (OPRK1)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

OPRK1 is a 42.5 kDa protein encoded by a 1,140 bp open reading frame (NM_000912.5) with seven transmembrane domains characteristic of Class A GPCRs . Key structural features include:

FeatureSpecification
Amino Acid Range1-58 (common recombinant fragment)
DomainsN-terminal extracellular domain, intracellular C-terminus
Post-Translational ModificationsGlycosylation sites at Asn8 and Asn22
Expression SystemsHEK293, Wheat Germ, E. coli

Functional Roles

OPRK1 mediates diverse physiological processes through interaction with endogenous ligands (dynorphins) and exogenous compounds (salvinorin A, synthetic opioids) :

FunctionMechanismAssociated Pathway
Pain ModulationInhibits adenylate cyclase via Gαi/o couplingOpioid receptor signaling
NeurotransmissionReduces Ca²⁺ influx/K⁺ effluxNeuronal hyperpolarization
Behavioral EffectsModulates aversion responsesStress-related behaviors
Autonomic RegulationControls salivation/endocrine secretionNeuroendocrine signaling

Pain Research

Recombinant OPRK1 enables:

  • Quantification of ligand binding affinity (Kd = 0.8 nM for U50,488)

  • Characterization of tissue-specific expression:

TissueOprk1+ Afferents
Colon60%
Bladder50%
Muscle7%

Data from single-cell RT-PCR studies show co-expression with pain-related markers (TRPV1 in 95%, CGRP in 97%) .

Addiction Studies

Functional assays using recombinant receptors revealed:

  • 83% reduction in cAMP production upon dynorphin activation

  • Enhanced alcohol preference in OPRK1 knockout models

  • Salvinorin A binding kinetics (kon = 5.6×10⁷ M⁻¹s⁻¹)

Pharmacological Profile

Standardized testing protocols use recombinant OPRK1 to evaluate drug candidates:

Assay TypeProtocolKey Findings
cAMP InhibitionHEK293 transfectionEC50 = 3.2 nM for dynorphin A
Calcium FluxFLIPR Tetra SystemIC50 = 11 nM for nor-BNI antagonist
Radioligand Binding³H-DiprenorphineBmax = 2.8 pmol/mg protein

Clinical Relevance

Genetic studies link OPRK1 variants to:

  • 2.1× increased risk of opioid addiction (rs997917)

  • Altered naltrexone response in alcohol dependence

  • Reduced thermal pain sensitivity (rs6473797)

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you require a specific format, please specify your request when placing the order. We will fulfill your demand to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is decided during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
OPRK1; OPRK; Kappa-type opioid receptor; K-OR-1; KOR-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-380
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAIPV IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYL MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI CIWLLSSSVGISAIVLGGTKVREDVDVIECSLQFPDDDYSWWDLFMKICVFIFAFVIPVL IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALG STSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPLKMRMERQSTSRV RNTVQDPAYLRDIDGMNKPV
Uniprot No.

Target Background

Function
The kappa-type opioid receptor (OPRK1) is a G-protein coupled receptor that serves as a receptor for endogenous alpha-neoendorphins and dynorphins, but has low affinity for beta-endorphins. It also functions as a receptor for various synthetic opioids and the psychoactive diterpene salvinorin A. Ligand binding triggers a conformational change, initiating signaling via guanine nucleotide-binding proteins (G proteins) and modulating the activity of downstream effectors, such as adenylate cyclase. This signaling leads to the inhibition of adenylate cyclase activity. It inhibits neurotransmitter release by reducing calcium ion currents and increasing potassium ion conductance. OPRK1 plays a crucial role in pain perception. It mediates reduced physical activity upon treatment with synthetic opioids and regulates salivation in response to these opioids. Furthermore, it may contribute to arousal and the regulation of autonomic and neuroendocrine functions.
Gene References Into Functions
  1. OPRK1 gene variants have been significantly associated with susceptibility to opioid dependence in Iranian populations. PMID: 28786760
  2. Downregulation of KOR in HCC tumor tissues has a strong correlation with poor prognosis, suggesting KOR might function as a potential tumor suppressor. PMID: 28821282
  3. In HUVEC cells subjected to artificial hyperlipidemia, selective agonists and antagonists have demonstrated that kappa-opioid receptor stimulation normalizes endothelial ultrastructure and function under hyperlipidemic conditions via the PI3K/Akt/eNOS pathway. PMID: 27226238
  4. The OPRK1/kappa-opioid receptor pathway has been found to be downregulated in lesional skin of psoriasis, correlating positively with itch sensation. PMID: 27958613
  5. Research indicates that KOR can form a heterodimer with B2R, leading to increased protein kinase A activity through the CREB signaling pathway, resulting in a significant increase in cell proliferation. PMID: 28069442
  6. Promoter fragments of OPRK1 and OPRM1 have been shown to upregulate gene expression in individuals with mild cognitive impairment. PMID: 27838450
  7. Hypoxia inducible factor-1alpha (HIF-1alpha) siRNA knocked down the increase of endogenous HIF-1alpha messages and diminished the desferrioxamine (DFO)-induced increase of kappa-opioid receptor (hKOR) expression. PMID: 28117678
  8. Genetic association studies in a Danish population suggest that carriers/heterozygotes of the C allele (CC/CT) of OPRK SNP rs6473799 report a 30.4% higher mechanical visceral pain tolerance threshold than non-carriers. PMID: 27061127
  9. Molecular switches of the kappa opioid receptor triggered by 6'-GNTI and 5'-GNTI have been described. PMID: 26742690
  10. Data provide evidence for genetic modulation of opioid withdrawal severity. PMID: 26692286
  11. OPRK1 promoter hypermethylation might increase the risk of AD through its regulation on the gene expression of OPRK1. PMID: 26300544
  12. OX1R and KOR heterodimerize, and this heterodimer associates with Galphas, leading to increased protein kinase A (PKA) signaling pathway activity, including upregulation of intracellular cAMP levels. PMID: 25866368
  13. The structure of the dynorphin (1-13) peptide (dynorphin) bound to the human kappa opioid receptor (KOR) has been determined by liquid-state NMR spectroscopy. PMID: 26372966
  14. RGS2 and RGS4 are new interacting partners that play key roles in G protein coupling to negatively regulate kappa-OmicronR signaling. PMID: 25289860
  15. Data show that the crystallographic structures of the mouse mu-opioid receptor (MOPr) and human kappa-opioid receptor (KOPr) indicate putative interfacial interactions. PMID: 24651466
  16. This research describes three experimental procedures used to evaluate the interaction between hKOPR and 14-3-3zeta: co-immunoprecipitation, pull-down assay, and immunofluorescence microscopy. PMID: 25293321
  17. Differential DNA-protein interactions of PDYN and OPRK1 SNPs significantly associated with alcohol dependence were studied. PMID: 25177835
  18. Results suggest that Kappa receptor availability in an amygdala-cingulate cortex-striatal circuit mediates the phenotypic expression of trauma-related loss (ie, dysphoria) symptoms. PMID: 25229257
  19. Low OPRK1 expression is associated with liver metastases of small bowel neuroendocrine tumors. PMID: 25241033
  20. Data indicate that replacement of the 3-hydroxyl substituent of the 4-(3-hydroxyphenyl) group of JDTic with a H, F, or Cl substituent leads to potent and selective kappa opioid receptor (KOR) antagonists. PMID: 25133923
  21. Findings suggest that genetic polymorphisms in OPRK1 were associated with body weight, alcohol use, and opioid withdrawal symptoms in MMT patients. PMID: 24525640
  22. Suggest that methamphetamine induced early autophagic response is a survival mechanism for apoptotic endothelial cells and is mediated through the kappa opioid receptor. PMID: 24603327
  23. In heroin-dependent patients, no difference was evidenced between responders and non-reponders to buprenorphine therapy in the frequency of OPRK1 SNP. PMID: 24274990
  24. Neurocognitive and neuroinflammatory correlates of OPRK1 mRNA expression in the anterior cingulate in postmortem brain of HIV-infected subjects. PMID: 24405578
  25. This study indicates that a patient's OPRK1 genotype could be used to identify a subset of individuals for whom vaccine treatment may be an effective pharmacotherapy for cocaine dependence. PMID: 23995774
  26. OPRK1 rs6989250 C>G is associated with stress-induced craving and cortisol, hyperactive hypothalamus/thalamus-midbrain-cerebellum responses, and also associated with greater subsequent cocaine relapse risk. PMID: 23962922
  27. Data suggest that dynorphin A (DynA) is a ligand for opioid receptor kappa (KOR); upon DynA binding, only small chemical shifts observed in the second extracellular loop of KOR; chemical shift changes of DynA show conclusively that DynA interacts with KOR. PMID: 24616919
  28. The crystal structure provides fundamental insights into the activation mechanism of the kappa-opioid receptor and suggests that "functional" residues may be directly involved in transduction of the agonist binding event. PMID: 24121503
  29. The kappa Opioid receptor in the nucleus is a novel prognostic factor of esophageal squamous cell carcinoma. PMID: 23574786
  30. OPRK1 and PDYN polymorphisms may alter the severity of HIV infection and response to treatment. PMID: 23392455
  31. Pairwise tag single nucleotide polymorphisms (SNPs) in DREAM, PDYN, and OPRK1 were genotyped in a United Kingdom population-based discovery cohort in whom pain was assessed. PMID: 22730276
  32. hKOR activates p38 MAPK through a phosphorylation and arrestin-dependent mechanism; however, activation differs between hKOR and rKOR for some ligands. PMID: 23086943
  33. Data indicate that 14-3-3zeta interaction with kappa-opioid receptor (hKOPR) C-tail promotes export of hKOPR. PMID: 22989890
  34. A role is established for dynorphin kappa-opioid receptor signaling in fear extinction. PMID: 22764240
  35. The crystal structure of the human kappa-OR in complex with the selective antagonist JDTic, arranged in parallel dimers, at 2.9 A resolution. PMID: 22437504
  36. Human apelin forms a heterodimer with the kappa opioid receptor and leads to increased protein kinase C and decreased protein kinase A. PMID: 22200678
  37. In summary, this study provides evidence that gene-gene interaction between KOR and OPRM1 can influence the risk of addiction to narcotics and alcohol. PMID: 22138325
  38. These findings provide evidence that previously demonstrated KOR-mediated reduction in intraocular pressure could be caused, in part, by NO production in both the ciliary body and the trabecular meshwork. PMID: 21666232
  39. This is the first report detailing the initiation of a KOR-induced JAK2/STAT3 and IRF2 signaling cascade, and these pathways result in substantial down-regulation of CXCR4 expression. PMID: 21447649
  40. Due to its stronger binding for hKOPR, GEC1 is able to be recruited by hKOPR sufficiently without membrane association via its C-terminal modification; however, du GABARAP appears to require C-terminal modifications to enhance KOPR expression. PMID: 21388957
  41. Review: kappa-Opioid receptor signaling and brain reward function. PMID: 19804796
  42. Phosphorylation of serine 369 mediates KOR desensitization and internalization. PMID: 12815037
  43. Binding of the KOR to NHERF-1/EBP50 facilitates oligomerization of NHERF-1/EBP50, leading to stimulation of NHE3. PMID: 15070904
  44. OPKR1 structure and association of haplotypes with opiate addiction were found to have empirical significance. PMID: 15608558
  45. The diterpenoid salvinorin A utilizes unique residues within a commonly shared binding pocket to selectively activate KORs. PMID: 15952771
  46. GEC1 interacts with the kappa opioid receptor and enhances expression of the receptor. PMID: 16431922
  47. Family-based analyses demonstrated associations between alcohol dependence and multiple SNPs in intron 2 of OPRK1. PMID: 16924269
  48. Helical orientation of helix 2 are critical for the selectivity of salvinorin A binding to KOR and provide a structurally novel basis for ligand selectivity. PMID: 17121830
  49. The frequency of KOR 36G > T SNP was significantly higher among heroin-dependent individuals compared with control subjects. PMID: 17373729
  50. Activation of KORs alters functional properties of neural precursor cells that are relevant to human brain development and repair. PMID: 17538007

Show More

Hide All

Database Links

HGNC: 8154

OMIM: 165196

KEGG: hsa:4986

STRING: 9606.ENSP00000265572

UniGene: Hs.106795

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in brain and placenta.

Q&A

What is the functional role of the kappa opioid receptor (OPRK1)?

OPRK1 is a G-protein coupled opioid receptor that primarily functions as a receptor for endogenous alpha-neoendorphins and dynorphins, while showing low affinity for beta-endorphins. It also serves as a receptor for various synthetic opioids and the psychoactive diterpene salvinorin A. The receptor's activation triggers conformational changes that initiate signaling through guanine nucleotide-binding proteins (G proteins), modulating downstream effectors such as adenylate cyclase. This signaling cascade results in inhibition of adenylate cyclase activity, reduction of calcium ion currents, and increased potassium ion conductance, ultimately inhibiting neurotransmitter release.

OPRK1 plays multiple physiological roles, including pain perception regulation, mediating reduced physical activity upon exposure to synthetic opioids, and controlling salivation in response to synthetic opioids. Research suggests it may also participate in arousal and regulation of autonomic and neuroendocrine functions.

What is the amino acid sequence of the recombinant human OPRK1 fragment used in research?

The recombinant human kappa opioid receptor protein fragment commonly used in research corresponds to amino acids 1-58 of the human sequence. The specific amino acid sequence is:

M D S P I Q I F R G E P G P T C A P S A C L P P N S S A W F P G W A E P D S N G S A G S E D A Q L E P A H I S P A I

This fragment is typically expressed in wheat germ expression systems for research applications such as SDS-PAGE, ELISA, and Western blotting.

How does OPRK1 signaling influence neuronal function?

OPRK1 activation exerts significant effects on neuronal function through multiple mechanisms. Upon ligand binding, OPRK1 inhibits neurotransmitter release by reducing calcium ion currents while simultaneously increasing potassium ion conductance. This modulation of ion channels directly impacts neuronal excitability and synaptic transmission.

In the context of neurogenesis, OPRK1 agonists such as U50,488H and dynorphin A inhibit adult neurogenesis by hindering the neuronal differentiation of neural stem cells (NSCs) in the hippocampus. This inhibitory effect operates through a molecular pathway involving microRNA-7a-5p (miR-7a-5p), which targets and inhibits the expression of Pax6, a transcription factor critical for neuronal differentiation. The downstream effects include downregulation of neurogenesis-related genes including Neurog2 and NeuroD1.

What experimental approaches are most effective for studying OPRK1 pharmacology in vitro?

Multiple complementary assays have been established to comprehensively characterize OPRK1 pharmacology:

  • Dynamic Mass Redistribution (DMR): This integrated, unbiased approach assesses real-time activation of intracellular signaling pathways. DMR is typically conducted using Chinese Hamster Ovary (CHO) cells stably expressing human kappa receptors. The technique allows monitoring of compound-triggered DMR signals with a temporal resolution of 44 seconds.

  • Bioluminescence Resonance Energy Transfer (BRET) Assays: These provide direct measurement of receptor-protein interactions:

    • OPRK1-G protein interaction assays using kappa-RLuc/Gβ1-RGFP expressing cells

    • OPRK1-β-arrestin 2 recruitment assays using kappa-RLuc and β-arrestin 2-RGFP

  • Calcium Mobilization Assays: Since OPRK1 natively couples to Gi/o heterotrimeric G proteins, calcium mobilization requires chimeric Gq/i proteins to translate receptor activation into measurable calcium signals.

These methods collectively provide a comprehensive pharmacological fingerprint of OPRK1 and its ligands, enabling researchers to detect subtle differences in signaling patterns and biased agonism.

How do genetic variations in OPRK1 influence its function and disease susceptibility?

Genetic variations in OPRK1 have been associated with the risk for alcohol dependence. Sequencing studies comparing DNAs from individuals with higher and lower risk haplotypes have identified numerous single nucleotide polymorphisms (SNPs) and insertions/deletions (indels) that may influence receptor function.

Notable genetic variations include:

  • Six novel SNPs (rs35970029, rs34418807, rs35991105, rs34709943, rs35373196, rs35160174)

  • A complex indel involving an 11 bp deletion from positions -1975 to -1985 relative to the translation start site

  • An additional 830 bp indel in some individuals

These genetic variations likely affect OPRK1 expression levels and/or function, potentially altering individual responses to endogenous opioids and susceptibility to conditions such as alcohol dependence. The functional consequences of these variations can be studied using promoter activity assays with constructs containing different variants, as outlined in the table below:

Fragment NamePosition*Primer PairsDNA SampleLength (bp)
OPRK-1.6-1647 to -10HE3059/HE306150031638
OPRK-2.3-2312 to -10HE3058/HE306150032303
OPRK-3.1-2312 to -10**HE3058/HE30616006**3133**

*Position relative to the translational start site of OPRK1 (NM_000912) on the NCBI reference genome (NT_008183.18)
**Individual 6006 has DNA with the indel; amplification produced a fragment with an additional 830 bp indel

What mechanisms underlie OPRK1 agonist-mediated inhibition of neurogenesis?

OPRK1 agonists (U50,488H and dynorphin A) inhibit adult neurogenesis through a precisely regulated molecular pathway. This inhibition occurs by hindering the neuronal differentiation of neural stem cells (NSCs) in the mouse hippocampus, both in vitro and in vivo. The specificity of this effect is demonstrated by its blockade with nor-binaltorphimine (nor-BNI), a selective OPRK1 antagonist.

The molecular mechanism involves:

  • OPRK1 agonist binding induces expression of miR-7a-5p

  • miR-7a-5p specifically targets Pax6 by directly interacting with its 3'-UTR sequence

  • Downregulation of Pax6 expression leads to decreased levels of downstream transcription factors Neurog2 and NeuroD1

  • The reduced expression of these neurogenesis-related genes prevents proper neuronal differentiation of NSCs

This mechanism is significant because defective adult neurogenesis has been associated with psychiatric disorders, including depression. Since OPRK1 is a crucial mediator of depressive-like behaviors, this pathway provides a potential link between OPRK1 activation, reduced neurogenesis, and depression pathophysiology.

How can biased signaling at OPRK1 be quantified for drug development applications?

Biased signaling—the differential activation of distinct downstream pathways by different ligands—can be quantified at OPRK1 using parallel assays measuring G-protein coupling and β-arrestin recruitment:

  • BRET-based G-protein interaction assay: Utilizes SH-SY5Y human neuroblastoma cells co-expressing kappa-RLuc and Gβ1-RGFP fusion proteins. This assay measures receptor-G protein coupling directly through bioluminescence resonance energy transfer.

  • BRET-based β-arrestin 2 recruitment assay: Employs cells expressing kappa-RLuc and β-arrestin 2-RGFP to quantify β-arrestin recruitment following receptor activation.

Results from these assays can be used to calculate bias factors, comparing the relative efficacy of different ligands in activating G-protein versus β-arrestin pathways. For example, in studies of novel OPRK1 ligands such as PWT2-Dyn A and Dyn A-palmitic, researchers found that while both compounds showed similar pharmacology to the parent peptide dynorphin A, Dyn A-palmitic demonstrated a significant bias toward G-protein signaling.

This approach enables rational design of biased OPRK1 ligands that could potentially retain therapeutic effects while minimizing unwanted side effects associated with particular signaling pathways.

What are the optimal expression systems for producing recombinant human OPRK1 protein?

For research applications requiring recombinant human OPRK1 protein fragments, wheat germ expression systems have proven effective for producing the N-terminal fragment (amino acids 1-58). The resulting recombinant protein is suitable for applications including SDS-PAGE, ELISA, and Western blotting.

For functional studies requiring full-length OPRK1, mammalian expression systems are preferred. Chinese Hamster Ovary (CHO) cells have been successfully used for stable expression of human OPRK1, maintained in DMEM/F12 supplemented with 10% FCS, antibiotics, and G418 selection (400 μg/ml) to maintain expression.

For BRET-based interaction studies, SH-SY5Y human neuroblastoma cells have been effectively employed for co-expression of OPRK1 fusion proteins with various partners. These cells can be maintained in DMEM/F12 (1:1) medium supplemented with 10% FBS, 2 mM L-Glutamine, and appropriate antibiotics for selection.

What techniques are most effective for detecting OPRK1 expression in tissue samples?

Multiple complementary techniques can be used to detect OPRK1 expression in tissue samples:

  • Immunohistochemistry (IHC): Rabbit polyclonal antibodies against OPRK1 have been validated for IHC on paraffin-embedded (IHC-P) tissue sections. This approach allows visualization of receptor distribution within complex tissues.

  • Immunocytochemistry/Immunofluorescence (ICC/IF): OPRK1 antibodies have been validated for cellular localization studies using immunofluorescence techniques, enabling detailed analysis of subcellular distribution.

  • Western Blotting (WB): This technique allows quantitative analysis of OPRK1 protein levels in tissue homogenates. Commercial antibodies have been validated for this application, providing reliable detection of the receptor protein.

  • Genetic approaches: PCR-based methods can be used to amplify and analyze OPRK1 gene fragments for expression analysis or genetic variation studies. Specific primer pairs have been validated for different regions of the gene, as shown in the following table:

Primer PairPosition*Length
HE3026/HE3027-2312 to -1577736 bp (no indel); 1566 bp (with indel)
HE3028/HE3029-1647 to -928720 bp
HE3040/HE3041-1118 to -381738 bp
HE3032/HE3033-428 to 453881 bp

*Position relative to the translational start site of OPRK1

How should apparent contradictions in OPRK1 signaling data across different assays be resolved?

When encountering contradictory OPRK1 signaling data across different assays, researchers should consider several factors:

  • Assay sensitivity and kinetics: Different assays measure distinct aspects of receptor function with varying sensitivities and temporal resolutions. For example, BRET-based assays directly measure protein-protein interactions, while DMR provides an integrated cellular response. Comparing EC50 values across assays should account for these fundamental differences.

  • Cell type-specific effects: OPRK1 signaling can differ between cell types due to varying expression levels of downstream signaling components. Results from CHO cells versus SH-SY5Y cells may reflect true biological differences rather than technical artifacts.

  • Receptor reserve effects: In systems with high receptor expression, apparent potency may be increased compared to systems with lower expression levels.

  • Temporal considerations: G-protein coupling typically occurs rapidly (seconds to minutes), while β-arrestin recruitment and downstream effects may exhibit different kinetics. Ensure measurements are taken at appropriate time points for each pathway.

To resolve contradictions, experiments should include appropriate positive and negative controls, and ideally employ multiple complementary approaches to establish a consistent pharmacological profile. For example, a comprehensive characterization would include G-protein coupling assays, β-arrestin recruitment assays, and downstream functional responses measured in the same cellular background.

What criteria should be used to establish the selectivity of novel OPRK1 ligands?

Establishing the selectivity of novel OPRK1 ligands requires systematic evaluation against multiple criteria:

  • Receptor binding profile: Novel ligands should be tested for binding affinity (Ki values) against all three classical opioid receptors (μ, δ, κ) and the nociceptin/orphanin FQ receptor. A selectivity ratio of at least 100-fold is typically desired for a receptor-selective compound.

  • Functional activity across receptors: Beyond binding affinity, functional activity should be assessed using G-protein coupling assays across all opioid receptor subtypes. Compounds may show different selectivity profiles in binding versus functional assays.

  • Signaling pathway selectivity: Within OPRK1 signaling, compounds should be evaluated for potential biased signaling between G-protein and β-arrestin pathways. This can be quantified using bias factors calculated from parallel BRET assays measuring both pathways.

  • Antagonist sensitivity: Selective blockade by established OPRK1 antagonists like nor-binaltorphimine (nor-BNI) provides additional evidence for OPRK1-mediated effects. The ability of nor-BNI to block effects in cellular or in vivo models supports OPRK1 selectivity.

  • Species differences: Compounds should ideally be tested against human and relevant animal OPRK1 orthologs, as pharmacological properties can vary across species despite high sequence conservation.

How do OPRK1 genetic variations influence clinical outcomes in substance use disorders?

Genetic variations in OPRK1 have been significantly associated with the risk for alcohol dependence, suggesting an important role in substance use disorders. Several mechanisms likely contribute to these clinical associations:

  • Altered receptor expression: Variations in the promoter region of OPRK1, including the numerous SNPs and complex indels identified in sequencing studies, may alter transcriptional regulation and receptor expression levels. The 11 bp deletion from positions -1975 to -1985 and the 830 bp indel are particularly notable.

  • Modified ligand sensitivity: Coding region variations might alter receptor structure and function, potentially modifying sensitivity to endogenous dynorphins or exogenous compounds. These changes could affect the rewarding properties of substances of abuse.

  • Altered neurogenesis impacts: Given OPRK1's role in regulating adult neurogenesis, genetic variations that modify this function could impact neuroplasticity associated with addiction recovery and relapse.

  • Downstream signaling effects: Variations that influence the receptor's coupling preferences (G-protein vs. β-arrestin) could alter the balance of signaling pathways activated by endogenous dynorphins during stress and substance exposure.

For clinical applications, genetic screening for OPRK1 variations could potentially help identify individuals at higher risk for alcohol dependence or other substance use disorders, guiding preventive interventions. Furthermore, understanding how specific variations affect receptor function could inform personalized therapeutic approaches, including the selection of appropriate pharmacotherapies based on genetic profiles.

What is the therapeutic potential of biased OPRK1 ligands in treating neuropsychiatric disorders?

Biased OPRK1 ligands offer promising therapeutic potential for neuropsychiatric disorders by selectively activating beneficial signaling pathways while minimizing pathways associated with adverse effects:

  • Depression and anxiety: OPRK1 agonists have traditionally shown anti-reward and prodepressant effects, partly through β-arrestin signaling. G-protein biased OPRK1 agonists might retain analgesic properties while reducing dysphoric effects, potentially offering novel therapeutic approaches for mood disorders.

  • Addiction: Given OPRK1's role in modulating dopaminergic reward pathways, biased ligands could help reduce drug cravings and prevent relapse. The association between OPRK1 genetic variations and alcohol dependence further supports this potential application.

  • Neuroprotection: Understanding OPRK1's role in neurogenesis regulation through the miR-7a/Pax6 pathway suggests that appropriately targeted ligands might promote neurogenesis and provide neuroprotective effects relevant to neurodegenerative conditions.

  • Pain management: Biased OPRK1 agonists that favor analgesic pathways while minimizing dysphoric side effects could offer valuable additions to pain management approaches, particularly for patients with substance use disorders.

Recent research has demonstrated that novel ligands like Dyn A-palmitic show significant bias toward G-protein signaling compared to the parent peptide dynorphin A. This suggests the feasibility of developing compounds with tailored signaling profiles for specific therapeutic applications, potentially opening new avenues for treating conditions with limited current therapeutic options.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.