Recombinant Human Keratinocyte-associated protein 2 (KRTCAP2)

Shipped with Ice Packs
In Stock

Description

General Information

Keratinocyte-associated protein 2 (KRTCAP2) is a protein-coding gene in humans . It is located on chromosome 1q22 . KRTCAP2 is involved in glycosylation, a crucial process for cell recognition, immune response, and signal transduction .

  • Gene ID: 200185

  • Aliases: KCP2

Role in Gout

Recent research suggests a potential link between KRTCAP2 expression and gout .

  • Increased expression of KRTCAP2 is associated with an elevated risk of gout .

  • KRTCAP2 may influence urate production and clearance by modulating the expression and function of xanthine oxidoreductase (XOR) . The regulation of XOR gene expression by KRTCAP2 depends primarily on the modulation of core transcription factors such as Sp1 or PPARγ .

Mendelian Randomization Analysis

Mendelian randomization (MR) analysis has identified KRTCAP2 as one of several genes potentially involved in the pathogenesis of gout .

Table 1: Genes Significantly Associated with Gout in SMR Analysis

GeneLabelP_SMRAssociation with Gout Risk
THBS3THBS34.16 × 10-13Reduced
THBS3-AS11.88 × 10-8Reduced
KRTCAP2KRTCAP23.88 × 10-6Increased
KAT5KAT51.70 × 10-5Reduced
PGAP3PGAP33.24 × 10-5Increased

Biological Functions and Pathways

Enrichment analysis reveals KRTCAP2's involvement in various biological processes, molecular functions, and cellular components .

  • Biological Processes: Including negative regulation of double-strand break repair via homologous recombination, negative regulation of double-strand break repair, negative regulation of DNA repair, cellular response to glucose starvation, negative regulation of DNA recombination, and protein N-linked glycosylation .

  • Cellular Components: Such as the site of DNA damage, ribonuclease MRP complex, multimeric ribonuclease P complex, peptidase inhibitor complex, serine-type endopeptidase complex, and messenger ribonuclease P complex .

  • Molecular Functions: Encompassing ribonuclease P RNA binding, K48-linked polyubiquitin modification-dependent protein binding, ribonuclease P activity, fucosyltransferase activity, acyltransferase activity transferring groups other than amino-acyl, and mRNA regulatory element binding translation repressor activity .

KEGG pathway analysis identifies pathways primarily related to glycan biosynthesis and metabolism :

  • Transcriptional Misregulation in Cancer

  • Glycosaminoglycan Biosynthesis - Keratan Sulfate

  • Various Types of N-Glycan Biosynthesis

  • Malaria

  • N-Glycan Biosynthesis

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
KRTCAP2; KCP2; Keratinocyte-associated protein 2; KCP-2; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit KCP2; Oligosaccharyl transferase subunit KCP2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-162
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
KRTCAP2
Target Protein Sequence
MRIANRTRFSSPFLARGAGWTHGRGMMVVGTGTSLALSSLLSLLLFAGMQMYSRQLASTE WLTIQGGLLGSGLFVFSLTAFNNLENLVFGKGFQAKIFPEILLCLLLALFASGLIHRVCV TTCFIFSMVGLYYINKISSTLYQAAAPVLTPAKVTGKSKKRN
Uniprot No.

Target Background

Function
Keratinocyte-associated protein 2 (KRTCAP2) is a subunit of the oligosaccharyltransferase (OST) complex. This complex catalyzes the initial transfer of a defined glycan (Glc3Man9GlcNAc2 in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This is the first step in protein N-glycosylation, a cotranslational process. The OST complex associates with the Sec61 complex at the translocon, mediating protein translocation across the endoplasmic reticulum (ER). All subunits are essential for optimal enzyme activity. KRTCAP2 may be involved in the N-glycosylation of amyloid-beta precursor protein (APP) and modulate gamma-secretase cleavage of APP by enhancing PSEN1 endoproteolysis.
Gene References Into Functions
  1. Data strongly support the identification of KCP2 as a novel subunit of the N-glycosylation machinery in a subset of eukaryotes. PMID: 22266900
Database Links

HGNC: 28942

KEGG: hsa:200185

STRING: 9606.ENSP00000295682

UniGene: Hs.516671

Protein Families
KRTCAP2 family
Subcellular Location
Endoplasmic reticulum. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in skin, heart, placental, liver, skeletal muscle, kidney, pancreas, keratinocytes and dermal fibroblasts.

Q&A

What is KRTCAP2 and what is its primary function in human cells?

Keratinocyte-associated protein 2 (KRTCAP2) is a protein involved in N-glycosylation processes within cells. It encodes proteins that participate in the post-translational modification of other proteins through N-glycosylation, which is a critical process affecting protein folding, stability, and function. KRTCAP2 was originally identified in association with keratinocytes, but its expression has been documented across multiple tissue types. The protein plays a significant role in cellular processes related to protein modification and may influence various signaling pathways depending on the cellular context .

N-glycosylation mediated by KRTCAP2 affects various cellular functions including:

  • Protein folding and stability

  • Cell-cell recognition

  • Protein trafficking

  • Signal transduction

Alterations in KRTCAP2 expression can affect tumor progression and immune responses within the tumor microenvironment, suggesting its potential significance in cancer biology and immunology .

How is KRTCAP2 expression regulated in normal versus pathological tissues?

The regulatory mechanisms controlling KRTCAP2 expression include:

  • Transcriptional regulation: Likely influenced by tissue-specific transcription factors

  • Post-transcriptional modifications: May include miRNA regulation

  • Feedback mechanisms: Possibly related to cellular glycosylation requirements

  • Microenvironmental influences: Including inflammatory signals and hypoxic conditions

Research indicates that the upregulation of KRTCAP2 in HCC tissues correlates with unfavorable clinical outcomes, suggesting that its aberrant expression contributes to the pathogenesis and progression of liver cancer .

What are the recommended expression systems for producing recombinant human KRTCAP2?

For efficient expression of recombinant human KRTCAP2, several expression systems can be utilized, drawing upon methodologies that have proven successful for similar keratinocyte-associated proteins. While the search results don't specify expression systems directly for KRTCAP2, we can infer approaches based on similar proteins:

  • Bacterial Expression Systems:

    • Escherichia coli expression systems, particularly protease-deficient strains such as Rosetta™2(DE3), can be employed for KRTCAP2 expression .

    • Using a Small Ubiquitin-related Modifier (SUMO) fusion system has been shown to enhance expression levels and prevent degradation of recombinant proteins similar to KRTCAP2 .

  • Yeast Expression Systems:

    • Pichia pastoris has been utilized for expressing keratinocyte growth factors, which can be adapted for KRTCAP2 expression .

    • This system allows for proper protein folding and post-translational modifications.

  • Mammalian Expression Systems:

    • Human embryonic kidney (HEK293) or Chinese hamster ovary (CHO) cells provide more authentic post-translational modifications.

    • These systems are particularly relevant for KRTCAP2 given its role in N-glycosylation processes.

When choosing an expression system, researchers should consider the intended application of the recombinant protein and whether native glycosylation patterns are essential for the protein's function under investigation .

What purification strategies yield the highest purity and biological activity for recombinant KRTCAP2?

Based on successful approaches used for similar proteins, a multi-step purification strategy is recommended for recombinant KRTCAP2:

  • Affinity Chromatography:

    • Utilizing a hexahistidine tag (His-tag) followed by Ni-NTA affinity chromatography provides an efficient first purification step .

    • This approach allows for selective binding of the tagged recombinant protein.

  • Size Exclusion Chromatography:

    • Following affinity purification, Sephadex G-25 or similar size exclusion chromatography can be employed for desalting and further purification .

    • This step helps separate the protein of interest from smaller contaminants and salt.

  • Tag Removal and Secondary Affinity Purification:

    • If a SUMO-fusion strategy is employed, SUMO protease digestion can be performed to cleave the fusion tag.

    • A secondary Ni-NTA column purification can then capture the cleaved tags while allowing the target protein to flow through .

A typical purification protocol might achieve approximately 95% purity with yields of 10-15 mg/L of culture medium, based on comparable protein purification approaches . The biological activity of the purified KRTCAP2 should be verified using appropriate functional assays relevant to its role in N-glycosylation or its effects on cellular proliferation.

How does KRTCAP2 expression correlate with clinical outcomes in hepatocellular carcinoma?

KRTCAP2 expression has significant prognostic implications in hepatocellular carcinoma (HCC). According to research findings, high KRTCAP2 expression serves as an independent predictive factor for unfavorable prognosis in HCC patients . The correlation between KRTCAP2 expression and clinical outcomes in HCC can be summarized as follows:

These findings collectively establish KRTCAP2 as a valuable prognostic marker that could inform clinical decision-making and treatment strategies for HCC patients .

What is the relationship between KRTCAP2 expression and the tumor immune microenvironment?

KRTCAP2 expression demonstrates a significant inverse relationship with immune cell infiltration in the tumor microenvironment of hepatocellular carcinoma. This relationship has important implications for tumor immunobiology and potential therapeutic approaches:

  • Inverse Correlation with Immune Cell Infiltration:

    • High KRTCAP2 protein expression is associated with a lower proportion of CD8+ T cells in both the tumor and stroma regions .

    • Reduced CD68+ macrophage infiltration is observed in the stroma of tumors with high KRTCAP2 expression .

  • Relationship with Immune Checkpoint Molecules:

    • KRTCAP2 expression shows an inverse relationship with programmed cell death ligand-1 (PD-L1) expression in HCC tissues .

    • This negative correlation suggests potential implications for immune checkpoint inhibitor therapy.

  • Immunotherapeutic Response Prediction:

    • Analysis of immunophenoscores reveals that the low KRTCAP2 expression group demonstrates a stronger predicted response to immune checkpoint inhibitors .

    • This finding suggests KRTCAP2 could serve as a predictive biomarker for immunotherapy efficacy.

  • Potential Mechanisms:

    • The N-glycosylation function of KRTCAP2 may influence immune recognition and response.

    • Alterations in protein glycosylation mediated by KRTCAP2 likely affect tumor progression and immune responses in the tumor microenvironment .

These findings highlight KRTCAP2's potential role in immune evasion mechanisms employed by tumors and suggest its value as a predictive marker for immunotherapeutic responsiveness in HCC patients .

What cell models are most appropriate for studying KRTCAP2 function?

When investigating KRTCAP2 function, selecting appropriate cell models is critical for obtaining reliable and physiologically relevant results. Based on the available research, the following cell models are recommended:

  • Hepatocellular Carcinoma Cell Lines:

    • Given KRTCAP2's established role in HCC, liver cancer cell lines (e.g., HepG2, Huh7, HCCLM3) represent primary models for studying its oncogenic functions .

    • These models allow for investigation of KRTCAP2's effects on proliferation, invasion, and metastasis.

  • Normal Liver Cell Lines:

    • Normal hepatocyte cell lines provide essential controls for comparative studies.

    • These models help establish baseline KRTCAP2 expression and function in non-malignant conditions.

  • Immune Cell Co-culture Systems:

    • Given KRTCAP2's relationship with immune cell infiltration, co-culture systems with T cells and macrophages are valuable.

    • These systems can replicate the tumor-immune cell interactions observed in vivo .

  • Keratinocyte Models:

    • Primary keratinocytes or keratinocyte cell lines allow investigation of KRTCAP2's original identified function .

    • Human embryonic stem cell-derived keratinocytes (ESKCs) provide models for studying developmental aspects of KRTCAP2 function .

  • 3D Organoid Models:

    • Liver organoids more accurately recapitulate the in vivo architecture and cellular interactions.

    • These models are particularly valuable for studying KRTCAP2's role in the complex tumor microenvironment.

For genetic manipulation of KRTCAP2 expression in these models, CRISPR-Cas9, shRNA, or overexpression vectors can be employed depending on the specific research question being addressed.

What are the recommended methods for measuring KRTCAP2-mediated N-glycosylation effects?

To effectively measure and characterize KRTCAP2-mediated N-glycosylation effects, researchers should employ a multi-faceted approach incorporating various analytical and functional techniques:

  • Glycoprotein Detection and Quantification:

    • Lectin Blotting: Using specific lectins to detect and quantify changes in N-glycosylation patterns.

    • Periodic Acid-Schiff (PAS) Staining: For visualization and semi-quantitative assessment of glycoproteins.

    • Mass Spectrometry: For detailed characterization of glycan structures and identification of specific glycosylation sites on target proteins.

  • Functional Assays:

    • Enzyme Activity Assays: Measuring the activity of glycosylated enzymes to assess the functional impact of KRTCAP2-mediated glycosylation.

    • Cell Adhesion Assays: Evaluating how altered glycosylation affects cell-cell and cell-matrix interactions.

    • Protein Stability Assays: Determining how N-glycosylation influences protein half-life and degradation rates.

  • Glycosylation Pathway Analysis:

    • qPCR Analysis: For quantifying expression of genes involved in the N-glycosylation pathway alongside KRTCAP2 .

    • Western Blotting: For detecting changes in expression of key glycosylation enzymes and substrates.

    • Fluorescent Tagging of Glycans: For visualizing the trafficking and localization of glycosylated proteins.

  • Inhibitor Studies:

    • Using specific inhibitors of N-glycosylation (e.g., tunicamycin) to determine which cellular effects of KRTCAP2 are dependent on its glycosylation function.

  • Immunological Impact Assessment:

    • T Cell Proliferation Assays: To evaluate how KRTCAP2-mediated glycosylation affects T cell activation and proliferation .

    • Cytokine Expression Analysis: Measuring levels of inflammatory cytokines (IL-1β, IL-6, TNF-α, IFN-γ) to assess immune response modulation .

These methodologies should be employed in comparative studies between experimental conditions with altered KRTCAP2 expression levels to effectively characterize its specific role in N-glycosylation and subsequent cellular effects.

How does KRTCAP2 influence antigen presentation and T cell responses?

KRTCAP2's influence on antigen presentation and T cell responses represents a critical aspect of its immunological function, particularly in the context of cancer immunity. Based on the available research, KRTCAP2 appears to modulate these processes through several mechanisms:

  • Impact on Antigen Presentation Machinery:

    • High KRTCAP2 expression is associated with altered expression of antigen presentation pathway components.

    • KRTCAP2-mediated N-glycosylation may affect the structure and function of MHC molecules, potentially impairing proper antigen loading and presentation .

  • Modulation of T Cell Infiltration and Activation:

    • Tumors with high KRTCAP2 expression show significantly reduced CD8+ T cell infiltration in both tumor and stromal regions .

    • This reduced infiltration suggests a potential role for KRTCAP2 in creating an immunosuppressive microenvironment.

    • The specific mechanisms may involve altered chemokine signaling or direct effects on T cell migration and activation.

  • Relationship with Immune Checkpoint Molecules:

    • KRTCAP2 expression demonstrates an inverse relationship with PD-L1 expression in hepatocellular carcinoma .

    • This relationship may influence the efficacy of immune checkpoint inhibitor therapies by affecting the PD-1/PD-L1 axis.

  • Experimental Evidence from Co-culture Studies:

    • In comparative studies between different cell types, those with higher KRTCAP2 expression show a limited capacity to stimulate the proliferation of T lymphocytes .

    • After stimulation with cells expressing high levels of KRTCAP2, T cells demonstrate reduced expression and secretion of pro-inflammatory cytokines including IL-1β, IL-6, TNF-α, and IFN-γ .

These findings collectively suggest that KRTCAP2 may contribute to tumor immune evasion by impairing antigen presentation and creating an immunosuppressive microenvironment that limits effective T cell responses against cancer cells .

Can KRTCAP2 expression predict response to immune checkpoint inhibitor therapy?

Evidence suggests that KRTCAP2 expression holds significant potential as a predictive biomarker for response to immune checkpoint inhibitor (ICI) therapy, particularly in hepatocellular carcinoma. Analysis of the relationship between KRTCAP2 expression and immunotherapy outcomes reveals several important observations:

  • Immunophenoscore Correlation:

    • Analysis of immunophenoscores indicates that patients with low KRTCAP2 expression demonstrate a stronger predicted response to immune checkpoint inhibitors compared to those with high expression .

    • This correlation suggests KRTCAP2 could serve as a stratification marker for patient selection in immunotherapy trials.

  • Mechanism of Predictive Value:

    • The predictive value likely stems from KRTCAP2's inverse relationship with:

      • CD8+ T cell infiltration in tumor tissues

      • PD-L1 expression levels

      • Presence of CD68+ macrophages in the stroma

    • These immune parameters are established predictors of immunotherapy response.

  • Potential Clinical Applications:

    • Pre-treatment assessment of KRTCAP2 expression could help identify patients most likely to benefit from ICI therapy.

    • KRTCAP2 expression analysis could be integrated into multi-parameter predictive models alongside other established biomarkers.

    • Monitoring KRTCAP2 expression changes during treatment might provide insights into developing resistance mechanisms.

  • Limitations and Considerations:

    • The predictive value needs validation in prospective clinical trials specifically designed to evaluate KRTCAP2 as a biomarker.

    • The relationship may vary across different cancer types and with different immune checkpoint inhibitors.

    • Standardization of KRTCAP2 measurement techniques would be necessary for clinical implementation.

This evidence supports further investigation of KRTCAP2 as part of a biomarker panel for predicting immunotherapeutic responsiveness, potentially improving patient selection and treatment outcomes for ICIs in HCC and possibly other cancers .

How does KRTCAP2 compare functionally to other proteins involved in N-glycosylation?

KRTCAP2 belongs to a complex network of proteins involved in cellular N-glycosylation processes. Understanding its comparative function helps position it within the broader glycosylation machinery:

  • Functional Comparison with Other Glycosylation Proteins:

    ProteinPrimary FunctionSubcellular LocalizationDisease AssociationRelationship to KRTCAP2
    KRTCAP2N-glycosylation componentEndoplasmic reticulum membrane (presumed)Hepatocellular carcinomaReference protein
    OST Complex ComponentsCatalyzes transfer of oligosaccharide to asparagine residuesEndoplasmic reticulum membraneCongenital disorders of glycosylationPotential functional partners of KRTCAP2
    MGAT Family EnzymesModify N-glycan structuresGolgi apparatusVarious cancersAct downstream of KRTCAP2-mediated processes
    ALG Family ProteinsEarly steps of N-glycan assemblyEndoplasmic reticulumCongenital disorders of glycosylationMay function upstream of KRTCAP2
  • Unique Aspects of KRTCAP2:

    • Unlike many glycosylation enzymes with well-defined catalytic activities, KRTCAP2 likely functions as a structural or regulatory component.

    • KRTCAP2's specific association with cancer progression suggests it may have unique roles beyond basic glycosylation processes .

    • Its inverse relationship with immune parameters indicates potential specialized functions in immune modulation not shared by all glycosylation proteins .

  • Differential Expression Patterns:

    • While many glycosylation proteins are ubiquitously expressed, KRTCAP2 shows tissue-specific expression patterns.

    • KRTCAP2's particularly strong association with keratinocytes and hepatocellular carcinoma suggests context-specific functions .

  • Evolutionary Conservation:

    • Analysis of KRTCAP2 conservation across species compared to other glycosylation proteins can provide insights into its evolutionary importance and functional specialization.

Understanding these comparative aspects is essential for positioning KRTCAP2 within the broader context of cellular glycobiology and for developing targeted approaches to modulate its activity for potential therapeutic applications.

What are the current contradictions in the literature regarding KRTCAP2 function?

The emerging research on KRTCAP2 presents several areas of uncertainty and potential contradictions that warrant further investigation:

  • Exact Biochemical Function:

    • While KRTCAP2 is described as being involved in N-glycosylation, its precise biochemical role—whether as an enzyme, scaffold protein, regulator, or transporter—remains incompletely characterized.

    • The specific glycoproteins that are modified through KRTCAP2-dependent processes have not been comprehensively identified.

  • Tissue-Specific Roles:

    • Despite its name indicating association with keratinocytes, KRTCAP2's most documented significant role appears to be in hepatocellular carcinoma .

    • Whether KRTCAP2 performs different functions in different tissue types remains unclear and potentially contradictory.

  • Causality in Cancer Progression:

    • It remains unresolved whether increased KRTCAP2 expression is a driver of cancer progression or a consequence of other oncogenic processes.

    • The mechanisms by which KRTCAP2 influences cancer outcomes—whether directly through glycosylation of specific oncoproteins or indirectly through immune modulation—require clarification .

  • Immune Regulatory Mechanisms:

    • The inverse relationship between KRTCAP2 expression and immune cell infiltration is established , but the causative mechanisms remain speculative.

    • Whether KRTCAP2 directly affects immune cell function or acts indirectly through modifying surface glycoproteins requires further investigation.

  • Therapeutic Implications:

    • The potential of KRTCAP2 as a therapeutic target versus a biomarker represents an ongoing area of debate.

    • The specificity of targeting KRTCAP2 and potential off-target effects on normal glycosylation processes present contradictory perspectives on its therapeutic utility.

Addressing these contradictions requires integrative approaches combining:

  • Advanced structural biology to determine KRTCAP2's precise molecular function

  • Comprehensive glycoproteomic analysis to identify KRTCAP2-dependent substrates

  • In vivo models with tissue-specific KRTCAP2 modulation

  • Clinical studies correlating KRTCAP2 expression with treatment outcomes

What are the most promising therapeutic approaches targeting KRTCAP2?

Based on current understanding of KRTCAP2's functions and associations, several therapeutic approaches show promise for targeting this protein in clinical settings:

  • Direct KRTCAP2 Inhibition Strategies:

    • Small Molecule Inhibitors: Development of compounds that specifically inhibit KRTCAP2's role in N-glycosylation.

    • Peptide-based Inhibitors: Designed to interfere with KRTCAP2 protein-protein interactions within the glycosylation machinery.

    • Antisense Oligonucleotides/siRNA: For targeted downregulation of KRTCAP2 expression, particularly viable for liver-targeted delivery given the protein's significance in HCC .

  • Combinatorial Approaches with Immunotherapy:

    • KRTCAP2 Inhibition + Immune Checkpoint Blockade: Given the inverse relationship between KRTCAP2 and PD-L1, combining KRTCAP2 targeting with anti-PD-1/PD-L1 therapy may enhance efficacy .

    • Adoptive Cell Therapy Enhancement: Modulating KRTCAP2 expression to improve tumor recognition by CAR-T or TIL therapy.

    • Vaccine Development: Using KRTCAP2 peptides as tumor-associated antigens for cancer vaccines.

  • Biomarker-Guided Treatment Selection:

    • Patient Stratification: Using KRTCAP2 expression levels to identify patients most likely to benefit from immunotherapy .

    • Treatment Monitoring: Tracking changes in KRTCAP2 expression during treatment to predict response or resistance development.

    • Combination Biomarker Panels: Integrating KRTCAP2 with other immune markers for more accurate prediction of treatment outcomes.

  • Glycosylation-Modifying Approaches:

    • Targeted Glycan Remodeling: Developing approaches to modify specific glycosylation patterns affected by KRTCAP2 expression.

    • Metabolic Glycoengineering: Using modified sugar precursors to alter glycosylation in KRTCAP2-overexpressing cells.

The most promising near-term application appears to be the use of KRTCAP2 as a predictive biomarker for immunotherapy response in HCC, while longer-term development of direct inhibitors represents a compelling but more challenging approach .

What experimental techniques are emerging for studying KRTCAP2 interactions and regulatory networks?

The study of KRTCAP2 interactions and regulatory networks is advancing through several cutting-edge experimental approaches that provide deeper insights into its functional roles:

  • Advanced Proteomic Techniques:

    • Proximity Labeling Methods: BioID or APEX2-based approaches to identify proteins physically interacting with KRTCAP2 in living cells.

    • Crosslinking Mass Spectrometry (XL-MS): For capturing transient protein-protein interactions within the glycosylation machinery.

    • Glycoproteomics: Advanced mass spectrometry techniques to identify glycosylation sites affected by KRTCAP2 expression.

  • CRISPR-Based Functional Genomics:

    • CRISPR Screens: Genome-wide or targeted screens to identify genes that synthetically interact with KRTCAP2.

    • CRISPRi/CRISPRa: For precise modulation of KRTCAP2 expression to study dose-dependent effects.

    • Base Editing/Prime Editing: For introducing specific mutations to study structure-function relationships.

  • Single-Cell Technologies:

    • Single-Cell RNA-Seq: To analyze cell-type-specific effects of KRTCAP2 expression in heterogeneous tissues.

    • Single-Cell Glycomics: Emerging techniques to characterize glycosylation at the single-cell level.

    • Spatial Transcriptomics: To map KRTCAP2 expression patterns within the tumor microenvironment with spatial context.

  • Advanced Imaging Techniques:

    • Super-Resolution Microscopy: For visualizing KRTCAP2 localization and dynamics at nanoscale resolution.

    • Live-Cell Glycan Imaging: Using chemical reporters to track glycosylation in real-time.

    • Multiplex Immunohistochemistry: For simultaneous visualization of KRTCAP2 with multiple immune markers in tissue samples .

  • Systems Biology Approaches:

    • Multi-omics Integration: Combining transcriptomics, proteomics, glycomics, and metabolomics data to construct regulatory networks.

    • Mathematical Modeling: Developing predictive models of how KRTCAP2 perturbations affect glycosylation networks.

    • Network Analysis: Identifying key nodes and regulatory hubs connected to KRTCAP2 function.

These emerging techniques will enable researchers to construct more comprehensive models of KRTCAP2's functional interactions and regulatory relationships, potentially revealing new therapeutic targets and biomarker applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.