Recombinant Human Killer cell immunoglobulin-like receptor 2DL1 (KIR2DL1)

Shipped with Ice Packs
In Stock

Description

Introduction to KIR2DL1

Killer cell immunoglobulin-like receptor 2DL1 (KIR2DL1) is an inhibitory transmembrane glycoprotein expressed on natural killer (NK) cells and subsets of T cells. It belongs to the KIR family, which regulates NK cell cytotoxicity by interacting with specific human leukocyte antigen (HLA) class I molecules, primarily HLA-C alleles with Lys80 (e.g., HLA-Cw2, -Cw4, -Cw5, -Cw6). Recombinant KIR2DL1 is engineered for research to study immune regulation, receptor-ligand interactions, and therapeutic applications .

Functional Mechanisms

KIR2DL1 suppresses NK cell activation upon binding to HLA-C ligands through inhibitory signaling:

  • Ligand Specificity: Recognizes HLA-C allotypes with Lys80 (HLA-C2 group) .

  • Inhibitory Signaling: ITIM domains recruit phosphatases (SHP-1/SHP-2), blocking activating receptor clustering and cytotoxicity .

  • Allelic Polymorphism: Over 14 alleles exist, with functional heterogeneity linked to residues like R245 in the transmembrane domain. R245-positive alleles exhibit stronger inhibition and durability of surface expression .

Table 1: Functional Impact of KIR2DL1 Allelic Polymorphism

Allele GroupStem Domain (Position 216)Transmembrane Domain (Position 245)Functional Outcome
Group 1Lysine (K)Arginine (R)Enhanced SHP-2/β-arrestin 2 recruitment; sustained surface expression; stronger inhibition.
Group 2Glutamate (E)Cysteine (C)Reduced inhibitory signaling; rapid downregulation upon ligand engagement.

Genetic and Functional Variability

  • SNP rs2304224: Associated with increased KIR2DL1 surface expression and NK cell frequency .

  • HLA-C2 Ligand Impact: Homozygous HLA-C2/C2 individuals show reduced KIR2DL1 expression, suggesting ligand-mediated receptor tuning .

Clinical and Therapeutic Relevance

  • Transplant Outcomes: KIR2DL1 allelic diversity influences donor-recipient compatibility in hematopoietic stem cell transplantation .

  • Cancer Immunotherapy: KIR2DL1-HLA interactions are exploited to enhance NK cell-mediated tumor targeting .

Applications in Research

Recombinant KIR2DL1 is utilized for:

  1. Mechanistic Studies: Elucidating NK cell education and tolerance .

  2. Therapeutic Development: Designing checkpoint inhibitors or adoptive NK cell therapies .

  3. Structural Biology: Mapping receptor-ligand interfaces via crystallography .

Production and Quality Control

  • Expression System: E. coli-derived inclusion bodies refolded into soluble protein .

  • Purity: >95% via proprietary chromatography .

  • Functional Validation: Binding assays with HLA-Cw4/Cw6 confirm biological activity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for customers.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
KIR2DL1; CD158A; NKAT1; Killer cell immunoglobulin-like receptor 2DL1; CD158 antigen-like family member A; MHC class I NK cell receptor; Natural killer-associated transcript 1; NKAT-1; p58 natural killer cell receptor clones CL-42/47.11; p58 NK receptor CL-42/47.11; p58.1 MHC class-I-specific NK receptor; CD antigen CD158a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-348
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEVTYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAESRSKVVSCP
Uniprot No.

Target Background

Function
Killer cell immunoglobulin-like receptor 2DL1 (KIR2DL1) is a receptor found on natural killer (NK) cells. It binds to specific HLA-C alleles (such as HLA-Cw4 and HLA-Cw6), inhibiting NK cell activity and preventing target cell lysis.
Gene References Into Functions
  1. KIR2D (L1, L3, L4, S4) and KIR3DL1 expression correlated with poor prognosis in non-small cell lung carcinoma patients. PMID: 27893413
  2. A negative association between KIR2DL1 polymorphism and susceptibility to type 1 diabetes mellitus was observed. PMID: 29384924
  3. The surface organization of paired KIRs, KIR2DL1 and KIR2DS1, on human primary NK cells and cell lines was examined. PMID: 27210755
  4. A significantly higher risk of chronic rejection after kidney transplantation was observed in recipient-donor pairs lacking functional rKIR-dHLA ligand combinations rKIR2DL1/dHLA-C2 and rKIR3DL1/dHLA-Bw4. PMID: 28686681
  5. CD16+ cells were significantly more frequent among NK cells lacking the inhibitory KIRs KIR2DL1, KIR2DL3, and KIR3DL1 compared to those expressing any one of these KIRs. iKIR+ NK cells exhibited poorer antibody-dependent cellular cytotoxicity than iKIR- NK cells. PMID: 27732638
  6. A novel KIR2DL1 variant allele, KIR2DL1*031, was identified through cDNA cloning and haplotype sequencing. PMID: 27577226
  7. KIR2DL1-C2C2 was found to be less frequent in type 1 diabetes in Saudi children. PMID: 26542066
  8. The influence of differently licensed KIR2DL1-positive NK cells in transplant recipients with acute leukemia was investigated. PMID: 26456260
  9. Educated NK cells expressing KIR2DL1 showed a functional advantage for anti-HIV-1 antibody-dependent activation. PMID: 26647083
  10. KIR2DL1*022 and 2DL1*026 evolved in the KhoeSan population after their divergence from other modern human populations. PMID: 26292085
  11. Regulatory interactions between HLA-C and KIR might promote graft-versus-leukemia effects after transplantation. PMID: 26416275
  12. Co-engagement of inhibitory receptors, KIR2DL1 or CD94-NKG2A, did not inhibit Stat5 phosphorylation but selectively inhibited Akt and S6 ribosomal protein phosphorylation. PMID: 26453750
  13. In a Chinese Han population, the frequency of the KIR2DL1 gene was increased in women with pre-eclampsia when the fetus was homozygous for the HLA-C2 allele. PMID: 24951171
  14. Array CGH showed a 95 Kb de novo duplication on chromosome 19q13.4 encompassing four KIR genes. PMID: 23952617
  15. ITIM phosphorylation is controlled by KIR self-association, and His-36 prevents unregulated signaling through KIR2DL1. PMID: 25505289
  16. C2 of KIR2DL1 is a novel risk factor, and homozygosity for C1 is a protective factor for childhood B-ALL. PMID: 25163702
  17. The association of HLA alleles and KIR ligands with oligoclonal band status in multiple sclerosis patients was investigated. PMID: 25037176
  18. The KIR2DL1(+)-HLA-C2(+) genotype was identified as a heritable risk factor for oral squamous cell carcinoma (OSCC), predisposing to earlier onset. PMID: 24818561
  19. Normal NK CD158a expression is associated with successful IVF and pregnancy. PMID: 23951916
  20. Donor KIR2DL1 allelic polymorphism affects recipient outcomes after allogeneic hematopoietic stem cell transplantation. PMID: 24043749
  21. Positive linkage disequilibrium was observed between KIR3DL1, 2DL1, 2DL3, and 2DS4, consistent with associations between constituents of A haplotypes. PMID: 23354323
  22. NK cell lysis of KG1A and K562 cells was analyzed to determine the effect of KIR2DL1 expression on cytotoxicity. PMID: 23865361
  23. Cytomegalovirus-positive individuals had lower proportions of NK cells expressing inhibitory receptors (KLRG1 and CD158a). PMID: 21933704
  24. 5-azacytidine treatment resulted in re-expression of the KIR2DL1 gene and increased expression of KIR2DL1, KIR2DL2, and KIR2DL3 genes in NK-92MI cells. PMID: 19549382
  25. Receptor-ligand dimensions, NKG2D/MICA and KIR2DL1/HLA-C, are important in NK cell recognition. PMID: 21179506
  26. Supervillin is a novel molecule that associates with the KIR2DL1 receptor and regulates inhibitory signaling in NK cells. PMID: 21070852
  27. Inhibitory receptor KIR2DL1 combined with HLA-C2 ligand confers susceptibility to chronic hepatitis B (CHB), while KIR2DL3 or KIR2DL3 homozygotes with HLA-C1C1 genotype show protection against CHB. PMID: 20643584
  28. A protective role of KIR2DL1/C2 in T1D was suggested. PMID: 20580654
  29. Eleven new KIR2DL1 alleles were identified by DNA sequencing from 100 African Americans. PMID: 20210923
  30. KIR2DL1 gene polymorphism and KIR/HLA-C gene compatibility are associated with type 1 diabetes. PMID: 20356536
  31. KIR activation and HLA expression density are critical determinants for rituximab treatment efficacy. PMID: 20056126
  32. Activating KIR2DS4 may be a CML susceptibility gene, while KIR2DS3 may be a protective gene for ALL. PMID: 19450876
  33. A positive correlation exists between NKG2D and CD161 expression and NK cytotoxicity, unlike CD158a and CD158b KIRs. PMID: 19711124
  34. KIR2DL1 interrupts TCR signaling, preventing dynamic membrane reorganization in CTL/tumor cell interactions. PMID: 12351398
  35. Engagement of activating KIR isoforms (CD158a or CD158b) by soluble HLA-I molecules induced programmed cell death of NK cells. PMID: 12393468
  36. Positive linkage disequilibrium was observed between KIR2DL1 and KIR2DL3. PMID: 12559621
  37. KIR2DL1 phosphorylation in the absence of adhesion and actin cytoskeleton rearrangement efficiently blocks early activation signals during NK-target cell contacts. PMID: 12794140
  38. Increased binding to influenza virus-infected cells was observed with KIR2DL1, which is functional and possibly results from MHC class I protein complex generation after infection. PMID: 12847262
  39. A significant decrease in NK cell CD158a expression was observed in women with recurrent spontaneous abortion. PMID: 15209394
  40. KIR2DS1 and KIR2DL1 share sensitivity to peptide sequence alterations, suggesting that activating and inhibitory receptors recognize the same self-MHC class I molecules with differing binding affinities. PMID: 16141329
  41. Posttranslational modifications, such as phosphorylation of a presented KIR2DL peptide, alter NK cell recognition of HLA-Cw4 and improve NK cell killing. PMID: 16709835
  42. A new KIR2DL1 allele was identified. PMID: 16774543
  43. Alleles 2DL1*00302 and *002, along with four new alleles (2DL1*00402, 2DL1*007, 2DL1*008, and 2DL1*009), were frequently observed in three families and 77 bone marrow transplant patients and donors. PMID: 17493149
  44. No correlation was observed between CD15ab expression and disease activity in rheumatoid arthritis. PMID: 17497034
  45. CD158a and CD158b exhibit a co-activatory function, involving the c-Jun NH2-terminal protein kinase signaling pathway, when expressed on malignant CD4+ T cells from a Sezary syndrome patient. PMID: 17522341
  46. KIR2DL1 induces opposing signaling outputs in CD4+ T cells depending on ligand binding. PMID: 18574028
  47. This study established a baseline of genetic information regarding KIR2DL1 and KIR2DS1 allele diversity. PMID: 18643963
  48. These findings provide insights into the molecular determinants of KIR2DL1 and its allelic polymorphism in disease susceptibility, transplant outcomes, and donor selection. PMID: 19828694
Database Links

HGNC: 6329

OMIM: 604936

KEGG: hsa:3802

STRING: 9606.ENSP00000336769

UniGene: Hs.654605

Protein Families
Immunoglobulin superfamily
Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Expressed by NK cells.

Q&A

What is KIR2DL1 and what is its role in immune regulation?

KIR2DL1 (also known as CD158a, formerly NKAT1) is a 348 amino acid type I transmembrane glycoprotein belonging to the human killer cell immunoglobulin-like receptor (KIR) family. It is primarily expressed on human CD56dim NK cells and certain T cell subsets, where it functions as an inhibitory receptor regulating effector functions in the innate immune system . KIR2DL1 contains two immunoreceptor tyrosine-based inhibitory motifs (ITIMs) within its long cytoplasmic tail that mediate inhibitory signaling by blocking activating receptor clustering when engaged with its ligand . Through this mechanism, KIR2DL1 plays a crucial role in NK cell self-tolerance and prevents autoimmunity while maintaining surveillance against abnormal cells.

How does KIR2DL1 differ from other KIR family members in structure and ligand specificity?

KIR2DL1 is distinguished from other KIR family members by its specific extracellular domain structure and ligand binding preferences. While it shares high amino acid sequence identity (92%) with KIR2DL2 in the extracellular domain, their ligand specificities differ significantly . KIR2DL1 specifically targets HLA-C2 allotypes containing lysine at position 80 (Lys80), whereas KIR2DL2 recognizes HLA-C1 allotypes containing asparagine at position 80 (Asn80) . This ligand specificity is crucial for understanding NK cell function, as together KIR2DL1-3 recognize and inhibit NK cytotoxicity against cells expressing any HLA-C allotype, allowing self-recognition while potentially conferring susceptibility to certain diseases like leukemia .

What methods are recommended for detecting KIR2DL1 expression on NK cells?

For accurate detection and quantification of KIR2DL1 expression on NK cells, flow cytometry represents the gold standard approach. This method allows researchers to simultaneously quantify both the abundance of KIR2DL1 on the cell surface (measured by median fluorescence intensity, MFI) and the percentage of NK cells expressing KIR2DL1 .

Recommended protocol:

  • Isolate peripheral blood mononuclear cells (PBMCs) using density gradient centrifugation

  • Stain cells with fluorochrome-conjugated antibodies specific for:

    • CD3 (to exclude T cells)

    • CD56 (to identify NK cells)

    • KIR2DL1-specific antibody (ensure specificity, as cross-reactivity with other KIRs can occur)

  • Include appropriate isotype controls and single-color controls for compensation

  • Analyze samples using multiparameter flow cytometry

  • Gate on CD3-CD56+ NK cells and assess KIR2DL1 expression

When interpreting results, consider that KIR2DL1 expression can be influenced by genetic factors such as copy number variation and allelic polymorphisms, which should be accounted for in experimental design and analysis .

How do polymorphisms in KIR2DL1 affect its expression and function?

KIR2DL1 exhibits significant allelic polymorphism that substantially impacts both its expression level and functional capacity. Research has identified several key single nucleotide polymorphisms (SNPs) that alter receptor behavior:

  • rs2304224 T variant: This polymorphism is associated with a 1.54-fold increase in KIR2DL1 surface expression and a 1.41-fold increase in the percentage of KIR2DL1+ NK cells (p=0.0002 and p=0.03, respectively) . Interestingly, this variant is also associated with decreased expression of its ligand HLA-C in individuals carrying HLA-C2 (p=0.0059), suggesting a compensatory mechanism in receptor-ligand evolution .

  • Arginine at position 245 (R245): The presence of this residue in the transmembrane domain significantly enhances inhibitory function. Compared to R245-negative alleles, KIR2DL1 alleles containing R245 demonstrate:

    • Enhanced recruitment of Src-homology-2 domain-containing protein tyrosine phosphatase 2 and β-arrestin 2

    • Greater inhibition of lipid raft polarization at the immune synapse

    • Increased stability of surface expression when interacting with ligands

These polymorphisms contribute to functional heterogeneity among KIR2DL1 alleles, affecting their ability to inhibit NK cell degranulation, interferon-γ production, and cytotoxicity against target cells expressing the HLA-Cw6 ligand .

What is the relationship between KIR2DL1 copy number variation and cell surface expression?

The relationship between KIR2DL1 copy number variation and its surface expression presents an interesting pattern. While copy number significantly affects the proportion of NK cells expressing KIR2DL1, it has a less pronounced effect on the expression level per cell:

  • KIR2DL1+ NK cell percentage: Individuals carrying two copies of KIR2DL1 (homozygous or heterozygous) show a 2.16-fold higher percentage of KIR2DL1+ NK cells compared to individuals with only one copy (p=0.0001) .

  • Surface expression intensity: The abundance of KIR2DL1 on NK cell surfaces (measured by MFI) shows only a borderline, non-significant difference between individuals with one versus two copies of the gene (p=0.0594) .

This differential effect suggests distinct regulatory mechanisms governing the frequency of receptor-positive cells versus the density of receptor expression per cell. These findings align with previous research by Béziat et al., reinforcing the observation that copy number more strongly influences the proportion of cells expressing the receptor rather than expression levels on individual cells .

How does the presence of HLA-C2 ligands affect KIR2DL1 expression?

The presence of HLA-C2 ligands demonstrates a regulatory effect on KIR2DL1 expression levels in what appears to be a feedback mechanism. Research indicates that KIR2DL1 expression is significantly decreased in individuals homozygous for the C2 ligand (C2/C2, p=0.007) . This suggests an adaptation mechanism where receptor expression is modulated based on the availability of its cognate ligand.

  • Le Luduec et al. observed that KIR2DL1 expression associates with C2 presence in a dose-dependent manner

  • More recent research found this association only in individuals carrying two copies of C2, not in heterozygotes

This ligand-mediated regulation of receptor expression represents an important consideration for experimental design when studying KIR2DL1 function, as the HLA-C genotype of study subjects may significantly impact baseline receptor expression.

What assays are most effective for analyzing KIR2DL1 inhibitory function?

For comprehensive assessment of KIR2DL1 inhibitory function, multiple complementary assays should be employed to measure different aspects of NK cell response inhibition:

  • Degranulation assay:

    • Measure CD107a surface expression on NK cells following stimulation with target cells expressing HLA-C2

    • Compare NK cells expressing different KIR2DL1 alleles or NK cells with KIR2DL1 knocked out/down

    • Include appropriate controls (HLA-C1 expressing targets or blocking antibodies)

  • Cytokine production assay:

    • Measure interferon-γ production by intracellular cytokine staining or ELISA following co-culture with target cells

    • Compare inhibition levels between different KIR2DL1 variants

  • Cytotoxicity assay:

    • Standard chromium release assay or flow cytometry-based killing assay using labeled target cells

    • YT-Indy cells (an NK cell line) transfected with different KIR2DL1 alleles can be particularly useful for standardized comparisons

  • Biochemical analysis of inhibitory signaling:

    • Immunoprecipitation to assess recruitment of signaling molecules like SHP-2

    • Phosphorylation assays to measure inhibition of activating signaling pathways

    • Analysis of lipid raft polarization at the immune synapse, which is differentially affected by KIR2DL1 variants

When comparing different KIR2DL1 alleles or conditions, researchers should account for variables such as surface expression levels, HLA-C genotype, and the presence of other inhibitory or activating receptors that may influence results.

How can recombinant KIR2DL1 be effectively used in immunological research?

Recombinant KIR2DL1 proteins, such as the KIR2DL1/CD158a Fc chimera protein, offer versatile research tools for investigating receptor-ligand interactions and NK cell function. Effective applications include:

  • Binding studies:

    • Use recombinant KIR2DL1-Fc fusion proteins to assess binding affinity to various HLA-C allotypes

    • Employ surface plasmon resonance (SPR) or ELISA-based methods to quantify binding kinetics

    • Compare binding of different KIR2DL1 allelic variants to identify structural determinants of ligand recognition

  • Blocking studies:

    • Apply recombinant KIR2DL1 to compete with cell-surface KIR2DL1 for binding to HLA-C2, thereby blocking inhibitory signaling

    • Assess functional consequences on NK cell activation, cytotoxicity, and cytokine production

    • Use as a potential therapeutic approach to enhance NK cell activity against tumors

  • Development of detection reagents:

    • Generate antibodies against recombinant KIR2DL1 for flow cytometry and immunohistochemistry

    • Create multimeric complexes to identify and quantify HLA-C2-expressing cells

  • Structural analysis:

    • Utilize purified recombinant protein for crystallography studies to determine three-dimensional structure

    • Investigate the molecular basis of allelic variations in receptor function

When working with recombinant KIR2DL1, researchers should confirm protein quality through SDS-PAGE, verify functionality through binding assays, and consider the effects of any fusion tags or modifications on receptor behavior .

What methods can be used to study the molecular mechanisms of KIR2DL1 signaling?

To elucidate the molecular mechanisms underlying KIR2DL1 signaling, researchers can employ several sophisticated approaches:

  • Signaling protein recruitment analysis:

    • Immunoprecipitation followed by western blotting to detect recruitment of signaling molecules like SHP-2 and β-arrestin 2 to KIR2DL1

    • Proximity ligation assays to visualize protein-protein interactions in intact cells

    • FRET or BRET assays to monitor real-time interactions between KIR2DL1 and signaling molecules

  • Lipid raft and immune synapse analysis:

    • Confocal microscopy with fluorescently labeled antibodies or fusion proteins to visualize distribution of receptors and signaling molecules at the immune synapse

    • Lipid raft isolation through detergent-resistant membrane fractionation

    • Live-cell imaging to track dynamic changes in receptor clustering and signaling complex formation

  • Mutagenesis studies:

    • Site-directed mutagenesis of key residues (such as R245) to assess their impact on signaling efficiency

    • Creation of chimeric receptors to identify domains critical for specific signaling functions

    • CRISPR/Cas9 genome editing to introduce specific KIR2DL1 variants into primary NK cells or cell lines

  • Phosphorylation pathway analysis:

    • Phospho-specific antibodies to monitor changes in phosphorylation of signaling molecules downstream of KIR2DL1

    • Phosphoproteomics to comprehensively identify targets affected by KIR2DL1 signaling

    • Specific inhibitors of signaling components to dissect the pathway

These approaches have revealed that KIR2DL1 alleles containing R245 recruit more SHP-2 and β-arrestin 2, leading to enhanced inhibition of lipid raft polarization at the immune synapse and greater stability of surface expression compared to R245-negative alleles .

What is the evidence linking KIR2DL1 polymorphisms to autoimmune diseases?

Research has established significant associations between KIR2DL1 polymorphisms and autoimmune conditions, particularly Type 1 Diabetes Mellitus (T1DM). A comprehensive meta-analysis of 13 independent case-control studies comprising 2076 T1DM cases and 1967 controls revealed:

The protective association is biologically plausible given KIR2DL1's role in inhibiting NK cell activity, potentially reducing autoimmune-mediated destruction of pancreatic β-cells. This inhibitory function may help maintain self-tolerance, with certain KIR2DL1 variants providing more effective inhibition of NK cell-mediated cytotoxicity against self tissues.

Table 1: Meta-analysis findings for KIR2DL1 association with T1DM

*Specific values not statistically significant in ethnic subgroup analysis

How might KIR2DL1 functional variations impact transplantation outcomes?

The functional heterogeneity among KIR2DL1 alleles has significant implications for transplantation outcomes, particularly in hematopoietic stem cell transplantation (HSCT) and solid organ transplantation. The presence of specific KIR2DL1 variants in donors or recipients may influence:

  • Graft-versus-host disease (GvHD) risk: KIR2DL1 alleles with enhanced inhibitory function (such as those containing R245) may reduce the risk of GvHD by providing stronger inhibitory signals to donor NK cells, preventing inappropriate targeting of recipient tissues .

  • Graft-versus-leukemia (GvL) effect: Conversely, strongly inhibitory KIR2DL1 variants might reduce beneficial GvL effects by limiting NK cell activity against residual leukemic cells.

  • Engraftment success: The balance between donor NK cell inhibition and activation influences the success of engraftment, with KIR2DL1 variants potentially affecting this balance.

  • Donor selection strategies: Understanding a donor's KIR2DL1 allelic profile could inform donor selection for optimal transplantation outcomes based on the recipient's HLA-C status.

Research indicates that KIR2DL1 alleles vary significantly in their ability to inhibit degranulation, interferon-γ production, and cytotoxicity, with molecular determinants like R245 affecting both signaling efficiency and receptor surface stability . These functional differences provide a mechanistic understanding of how KIR2DL1 allelic polymorphism may impact transplantation outcomes and could inform donor selection strategies.

What are the methodological approaches for studying KIR2DL1 in disease contexts?

Investigating KIR2DL1 in disease contexts requires a comprehensive methodological approach that integrates genetic, functional, and clinical analyses:

  • Genetic association studies:

    • Case-control design comparing KIR2DL1 gene presence/absence between patients and healthy controls

    • Genotyping for specific allelic variants, particularly those affecting function (e.g., R245 status)

    • Analysis of gene copy number variation

    • Consideration of KIR-HLA combinations, since KIR2DL1 function depends on interaction with HLA-C2 ligands

  • Functional assessment:

    • Ex vivo analysis of NK cells from patients and controls to assess KIR2DL1 expression and function

    • Comparison of inhibitory capacity between different patient groups

    • Correlation of functional data with genetic findings and clinical outcomes

  • Longitudinal studies:

    • Monitoring KIR2DL1+ NK cell frequencies and function over disease course

    • Assessing impact of therapeutic interventions on KIR2DL1-mediated regulation

    • Correlation with disease activity markers

  • Integrated analytical approaches:

    • Multivariate analysis incorporating KIR2DL1 genetics, expression, function, and clinical parameters

    • Stratification of patients based on KIR2DL1/HLA combinations to identify subgroups with distinct disease risk or progression patterns

These approaches have yielded important insights, including the protective association of KIR2DL1 against T1DM in meta-analysis studies (OR = 0.71) , and the identification of significant functional heterogeneity among KIR2DL1 alleles that may influence disease susceptibility and progression .

How do KIR2DL1 and HLA-C genes co-evolve, and what are the implications for NK cell function?

The co-evolution of KIR2DL1 and HLA-C genes represents a fascinating example of genetic adaptation in immune regulation. Evidence from comparative genomics and population genetics reveals several key aspects of this co-evolutionary relationship:

  • Complementary expression regulation: Research has identified an apparent compensatory mechanism where the KIR2DL1 variant rs2304224 T is associated with both increased KIR2DL1 expression and decreased expression of its ligand HLA-C in individuals carrying HLA-C2 (p=0.0059) . This suggests selective pressure maintaining optimal receptor-ligand interactions.

  • Signals of positive selection: Extended haplotype homozygosity analysis has identified signals of positive selection for rs4806553 G and rs687000 G variants, which are in linkage disequilibrium with rs2304224 T . This provides evidence for recent selective pressure on KIR2DL1 variants that affect receptor expression.

  • Reciprocal regulation mechanisms: KIR2DL1 expression is decreased in individuals homozygous for the C2 ligand (C2/C2, p=0.007) , suggesting the existence of feedback mechanisms that tune receptor expression based on ligand availability.

These co-evolutionary dynamics likely reflect balancing selection pressures from infectious disease resistance (favoring diverse and potentially activating KIR-HLA combinations) versus autoimmunity risk (favoring inhibitory combinations that maintain self-tolerance). The resulting variation contributes to individual differences in NK cell education, licensing, and functional responsiveness, with implications for infection susceptibility, autoimmunity risk, reproductive success, and cancer immunosurveillance.

What are the challenges in designing experiments to study KIR2DL1 specificity and function?

Researchers face several significant challenges when designing experiments to study KIR2DL1 specificity and function:

  • Genetic complexity:

    • High polymorphism of both KIR2DL1 and HLA-C genes

    • Linkage disequilibrium with other KIR genes

    • Copy number variation affecting expression levels

    • Need to account for these variables in experimental design and interpretation

  • Receptor expression heterogeneity:

    • Variable expression of KIR2DL1 between individuals and between NK cell subsets

    • Influence of the HLA-C background on receptor expression levels

    • Challenges in normalizing for these differences when comparing functional outputs

  • Antibody specificity issues:

    • Cross-reactivity between KIR2DL1 and other KIR family members

    • Difficulty in developing allele-specific antibodies that can distinguish functional variants

    • Need for careful validation of reagents for specificity

  • Functional redundancy:

    • Overlapping and complementary functions with other inhibitory receptors

    • Difficulties in isolating KIR2DL1-specific effects from those of other receptors

    • Complex integration of signals from multiple receptors

  • NK cell education effects:

    • NK cell responsiveness is calibrated by inhibitory receptor engagement during development

    • KIR2DL1+ NK cells from individuals with or without HLA-C2 may have different baseline responsiveness

    • Need to consider the educational status of NK cells when interpreting functional studies

To address these challenges, researchers should consider comprehensive genetic typing of experimental subjects, careful matching of cases and controls, inclusion of appropriate functional controls, and multi-parameter analysis approaches that can account for the complexity of NK cell regulation.

How might cutting-edge technologies advance our understanding of KIR2DL1 biology?

Emerging technologies offer exciting opportunities to deepen our understanding of KIR2DL1 biology across multiple domains:

  • Single-cell analysis technologies:

    • Single-cell RNA sequencing to characterize KIR2DL1+ NK cell subsets and their functional states

    • Single-cell proteomics to profile the co-expression of multiple receptors and signaling molecules

    • Combined single-cell transcriptomics and epigenetics to understand receptor expression regulation

    • These approaches can reveal previously unrecognized NK cell subsets defined by KIR2DL1 expression and functional heterogeneity within KIR2DL1+ populations

  • Advanced imaging technologies:

    • Super-resolution microscopy to visualize nanoscale organization of KIR2DL1 at the immune synapse

    • Live-cell imaging with fluorescent reporters to track real-time dynamics of inhibitory signaling

    • Multiplexed imaging to simultaneously visualize multiple components of the signaling pathway

    • These methods can provide unprecedented insight into the spatial and temporal dynamics of KIR2DL1 function

  • CRISPR/Cas9 genome editing:

    • Precise modification of KIR2DL1 variants in primary NK cells or cell lines

    • Creation of isogenic cell lines differing only in specific KIR2DL1 polymorphisms

    • Genome-wide CRISPR screens to identify novel regulators of KIR2DL1 expression and function

    • These approaches allow direct testing of the functional impact of specific genetic variants

  • Structural biology advances:

    • Cryo-electron microscopy to determine high-resolution structures of KIR2DL1-HLA-C complexes

    • Molecular dynamics simulations to understand how polymorphisms affect receptor-ligand interactions

    • These methods can provide molecular insights into how specific residues influence binding and signaling

By integrating these technological approaches with traditional genetic and functional studies, researchers can develop a more comprehensive understanding of how KIR2DL1 variation impacts NK cell function in health and disease, potentially leading to novel immunotherapeutic strategies targeting this receptor pathway.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.