Recombinant Human Killer cell immunoglobulin-like receptor 2DL2 (KIR2DL2)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Expression

Recombinant KIR2DL2 is typically produced as a fragment (amino acids 22–245) in HEK 293 cells, achieving ≥90% purity for biochemical assays like SDS-PAGE and size exclusion chromatography . Key structural features include:

  • Domains: Two extracellular immunoglobulin-like domains (D1 and D2) connected by a flexible hinge region critical for ligand binding .

  • Transmembrane and cytoplasmic regions: A type I transmembrane domain and cytoplasmic tail containing immunoreceptor tyrosine-based inhibitory motifs (ITIMs) that suppress NK cell activation .

  • Glycosylation: Post-translational modifications at asparagine residues (e.g., N70, N166) influence receptor stability and ligand interactions .

Functional Hierarchy of Inhibitory KIRs:

ReceptorLigand StrengthClinical Impact
KIR2DL1Strongest (C2)Associated with preeclampsia
KIR2DL2IntermediateDual role in viral control
KIR2DL3Weakest (C1)Protective in HCV clearance

Disease Associations

  • Viral infections: KIR2DL2 enhances HLA-B*54-mediated protection against HCV but exacerbates HTLV-1-associated neuroinflammation .

  • Cancer: High avidity for HLA-C1 correlates with leukemia susceptibility .

  • Pregnancy: Stronger inhibition by KIR2DL2 may contribute to placental disorders when paired with maternal HLA-C2 .

Experimental Tools

  • Tetramer staining: KIR2DL2-Fc chimeras detect HLA-C1 on live cells .

  • Peptide screens: Used to identify viral epitopes that modulate receptor binding .

Key Research Findings

  1. Structural plasticity: KIR2DL2 adopts distinct docking angles on HLA-C*07:02 compared to KIR2DL3, explaining its broader ligand repertoire .

  2. Linkage disequilibrium: Co-inherited with activating KIR2DS2, influencing NK cell education and viral response outcomes .

  3. Peptide selectivity: KIR2DL2-positive NK cells are less sensitive to peptide variations than KIR2DL3-positive cells, suggesting rigid binding kinetics .

Evolutionary and Population Genetics

  • Haplotype diversity: KIR2DL2 is enriched in B haplotypes, common in populations with high pathogen exposure (e.g., Native Americans) .

  • Allelic variation: Over 300 KIR genotypes exist, with KIR2DL2/3 polymorphisms affecting receptor expression and ligand specificity .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
KIR2DL2; CD158B1; NKAT6; Killer cell immunoglobulin-like receptor 2DL2; CD158 antigen-like family member B1; MHC class I NK cell receptor; Natural killer-associated transcript 6; NKAT-6; p58 natural killer cell receptor clone CL-43; p58 NK receptor CL-43; CD antigen CD158b1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-348
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVIGNPSNSWPSPTEPSSKTGNPRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEVTYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYAELPNAESRSKVVSCP
Uniprot No.

Target Background

Function
Receptor on natural killer (NK) cells for HLA-Cw1, 3, 7, and 8 allotypes. Inhibits NK cell activity, thus preventing cell lysis.
Gene References Into Functions
  1. Killer cell immunoglobulin like receptor two (KIR2DL2) exhibits a risk association with Chinese Han hepatitis C virus-1b (HCV-1b) patients who do not respond to pegylated alpha interferon (PEG-IFN) and ribavirin (RBV) combination therapy. PMID: 30039498
  2. KIR2DL2/HLA-C( *)12:02 and KIR2DL2/HLA-C( *)14:03 compound genotypes demonstrate protective effects against HIV-1 control. PMID: 27880898
  3. KIR2DL2 gene polymorphism is associated with HIV-1 infection. PMID: 26888639
  4. An association between KIR2DS2 and response to methotrexate (MTX) has been observed. Moreover, the KIR2DL2+/KIR2DS2+ combination was more frequent in MTX responders (p = 0.043). PMID: 27251940
  5. KIR2DL2/KIR2DL3-glutamate(35) alleles are functionally stronger than -glutamine(35) alleles. PMID: 27030405
  6. The KIR2DL2/2DS2-C1C1 genotype is linked to type 1 diabetes in Saudi children. PMID: 26542066
  7. A genetic association study in an Eastern Indian population suggests that interactions between KIRs (KIR2DL2, KIR2DS4, KIR2DL3) and HLA ligands (HLAC1, HLAC2) significantly contribute to susceptibility and protection against type 1 diabetes. PMID: 26031759
  8. Allelic polymorphism of KIR2DL2/2DL3 has been characterized in a southern Chinese population. PMID: 26423800
  9. A significant increase in the frequency of KIR2DL2 (P = 0.019) and KIR2DS2 (P = 0.008) was observed in patients with neuroblastoma compared to the healthy control group. PMID: 26202659
  10. Single Nucleotide Polymorphism in the KIR2DL2 gene is associated with Asthma and Atopic Dermatitis. PMID: 26430804
  11. Genetic polymorphism is associated with chronic hepatitis C and viremia levels in Poland. PMID: 25636579
  12. The KIR2DL2 and KIR2DS2 genotype is associated with protection against primary biliary cirrhosis in the Han population. PMID: 25575065
  13. Genetic risk for the co-occurrence of type 1 diabetes and celiac disease is modified by HLA-C and killer immunoglobulin-like receptors. PMID: 25329633
  14. Studies have shown an increase in HLA-C1/KIR2DL2 and HLA-C1/KIR2DL3 pairs in human papillomavirus high-risk infected patients (OR 3.05, 3.24) with invasive cervical cancer (OR 1.33, 3.68). PMID: 25188020
  15. KIR2DL3-positive NK cells demonstrate higher sensitivity to changes in MHC class I peptide content compared to KIR2DL2-positive NK cells. PMID: 25359276
  16. A significant increased correlation between KIR2DL2/DS2, type 2 diabetes, and HLA-C1C1 genotype was observed in type 2 diabetes patients infected with human herpesvirus 8. PMID: 24122895
  17. These findings suggest that inhibitory KIR2DL2 and KIR2DL3, alleles of the same locus, play a role in the inverse effects on PM and PM/HIV co-infection. PMID: 22715396
  18. These data indicate that naturally occurring sequence variations within HLA-C03:04-restricted HIV-1 p24 Gag epitopes can significantly impact the binding of inhibitory KIR2DL2 receptors and primary natural killer cell function. PMID: 24785948
  19. The strongest association for the development of epithelial ovarian cancer has been found between KIR2DL2 and HLA-C1 expression. PMID: 24755350
  20. HLA-C genotypes are important determinants of conjunctival scarring in trachoma, and KIR2DL2/KIR2DL3 heterozygosity further increases the risk of conjunctival scarring in individuals carrying HLA-C2. PMID: 24651768
  21. Combinations of KIR3DL1/HLA-Bw4, KIR2DL2/HLA-C1, and a genetic variant of the IL28B gene predict the response to PEG-IFN and ribavirin therapy in Japanese patients infected with genotype 1b HCV. PMID: 24349500
  22. The results of this study confirmed a potential effect of KIR2DL2 on viral infection susceptibility in multiple sclerosis patients. PMID: 24735502
  23. Different expression levels of KIR2DL2 may contribute to the abnormal function of natural killer (NK) and NKT lymphocytes, leading to the risk of systemic lupus erythematosus (SLE) susceptibility. PMID: 24839813
  24. The most common KIR2DL2/3 allelic products in European American and African American populations were evaluated. PMID: 23686481
  25. Data indicate that increased frequency of the activating receptor KIR2DS1 and a reduced frequency of the KIR-ligand combination KIR2DS2/2DL2 absent/C1 present were significantly associated with chronic myeloid leukemia (CML). PMID: 23380384
  26. The presence of KIR2DL2 is associated with rheumatoid arthritis. PMID: 22960345
  27. Engagement of KIR2DL2 might protect virus-infected cells from NK cell-mediated lysis. Selection of sequence polymorphisms that increase avidity to KIR2DL2 might provide a mechanism for HIV-1 to escape NK cell-mediated immune pressure. PMID: 22807681
  28. Individuals possessing the KIR2DL2 and/or KIR2DS2 (and, in most cases, also KIR2DL1) gene but lacking the HLA-C C2 ligand may respond better to treatment and have longer survival compared to those with other genotypes. PMID: 22836042
  29. The KIR2DS2/KIR2DL2 and HLA-C genotype of rheumatoid arthritis patients may provide predictive information for response to anti-TNF-alpha therapy. PMID: 21373785
  30. The results represent the first direct evidence of the involvement of KIR2DL2 receptor in the control of natural killer cell activation against herpes virus infection in multiple sclerosis. PMID: 22871633
  31. Amino acid variation at positions 68, 70, and 182 modulates the binding avidity of KIR2DL for histocompatibility antigen HLA-C compared to KIR2DL3. The interaction between the HLA-C epitope and KIR2DL2 strongly inhibits natural killer cell cytotoxicity. PMID: 22772445
  32. In a comparison of healthy controls and a well-defined cohort of adult ITP patients, the KIR2DS2/KIR2DL2 genotype was found to be associated with ITP independently of FCGR3a-158 polymorphisms. PMID: 22024796
  33. In two unrelated viral infections, hepatitis C virus and human T lymphotropic virus type 1, possession of the KIR2DL2 gene enhanced both protective and detrimental HLA class I-restricted anti-viral immunity. PMID: 22022261
  34. Four novel KIR2DL2 alleles and two novel KIR2DL3 alleles were identified from an East African population using sequence-based typing. PMID: 20875478
  35. Single nucleotide polymorphism in the KIR2DL2 gene is associated with posttransplantation non-Hodgkin lymphoma. PMID: 20207982
  36. The KIR2DL2, KIR2DL3 genotype is predisposing to Crohn's disease in the presence of the C1 ligand. PMID: 19789864
  37. Absence of KIR2DS2 and/or KIR2DL2 is associated with failure of antiviral therapy in patients with recurrent hepatitis C after liver transplantation. PMID: 19877200
  38. Individuals were subgrouped based on the major HLA-C encoded KIR-epitopes (group C1 versus C2). C2 individuals transcribe RNA from KIR2DL2 genes without specific HLA-C ligands. PMID: 12559621
  39. The genetic combination of KIR2DS2+ and KIR2DL2- is associated with scleroderma. PMID: 15146426
  40. KIR2DL2 is positively associated with diabetes mellitus, type 1. PMID: 15699512
  41. Due to minimal interference with the expression of CD158b on natural killer cells, monitoring this marker may be accurate and sensitive after kidney transplantation. PMID: 15848530
  42. KIRs on memory T cells function to uncouple effector functions by modifying the transcriptional profile while leaving granule exocytosis intact. PMID: 16469873
  43. Lack of KIR2DL2 is associated with poor graft function. PMID: 17445184
  44. In contrast to natural killer (NK) cells, the functions of killer inhibitory receptors in CD4+ T lymphocytes may originate from the selective expression of their activating or inhibiting (CD158b1) forms. PMID: 18292496
  45. Allelic polymorphism at sites distal to the ligand-binding site of KIR2DL2 has diversified this receptor's interactions with HLA-C. The interaction between the HLA-C epitope and KIR2DL2 strongly inhibits natural killer cell cytotoxicity. PMID: 18322206
  46. Allele typing data support the view that KIR2DL2 and KIR2DL3 are alleles of the same gene. PMID: 18498296
  47. Increased frequency was observed in the recurrent spontaneous abortion group. PMID: 18572300
  48. The role of DNA methylation in regulating the genes, KIR2DL2 and KIR2DL4, was characterized. These genes are normally suppressed, in part, by promoter methylation in non-expressing T cells. PMID: 18945643
  49. A combination of KIR2DL2- HLA-C1 plays a critical role in susceptibility or protection in Latvians against type 1 diabetes. PMID: 19046302
  50. Natural killer (NK) cells in a humanized mouse model express multiple killer inhibitory receptors in a stochastic manner, including HLA-Cw3-specific inhibitory receptor KIR2DL2. These mice reject wild-type mouse spleen cells upon intravenous injection. PMID: 19234149

Show More

Hide All

Database Links

HGNC: 6330

OMIM: 604937

KEGG: hsa:3803

UniGene: Hs.743949

Protein Families
Immunoglobulin superfamily
Subcellular Location
Cell membrane; Single-pass type I membrane protein.

Q&A

What is the genetic relationship between KIR2DL2 and KIR2DL3?

KIR2DL2 and KIR2DL3 have historically been given different names based on their cDNA sequences, but genome analysis and population studies indicate they may be alleles at the same locus. They share high homology in their structures and binding properties, though with different binding affinities. Genome studies demonstrate that these receptors appear on the same genetic locus but have evolved into distinct allelic variants with functional differences in their interactions with HLA-C ligands . This genetic relationship explains why individuals can have either KIR2DL2, KIR2DL3, or both in their genotype.

How does KIR2DL2 function in regulating NK cell activity?

KIR2DL2 functions primarily as an inhibitory receptor on Natural Killer cells, regulating immune responses by dampening NK cell activation when engaged with appropriate HLA-C ligands. When KIR2DL2 binds to its cognate ligands (primarily HLA-C1 group molecules), it delivers inhibitory signals that prevent NK cell degranulation and cytokine production. This inhibitory function is physiologically important for self-tolerance but can be exploited by pathogens. KIR2DL2 combines more strongly with HLA-C than KIR2DL3, potentially exerting a more powerful inhibitory effect that may promote survival of viruses by preventing early clearance . KIR expression on NK cells is largely random, creating diverse NK cell subpopulations with varying receptor combinations and functional capacities .

What are the primary HLA-C ligands for KIR2DL2 and how specific is this interaction?

While traditionally KIR2DL2 was thought to specifically recognize HLA-C molecules of the C1 group, research has revealed a broader spectrum of interaction. According to recent findings, KIR2DL2+ NK cells react similarly against HLA-C+ target cells regardless of whether they express C1 or C2 alleles . This contrasts with KIR2DL1, which shows strict specificity for C2 alleles. The research demonstrates that KIR2DL2 has a weaker affinity for C2 ligands with the N77K80 motif, but still maintains reactivity . This broader specificity may partially explain the predominance of KIR2DL2-expressing NK cells within the KIR repertoire in KIR2DL2-positive individuals.

How does KIR2DL2 expression impact susceptibility to COVID-19?

Research indicates that KIR2DL2 gene frequency is significantly higher in COVID-19 patients compared to healthy controls, suggesting a predisposition to infection. A study found a positive correlation between KIR2DL2 frequency in populations and the number of COVID-19 cases in specific geographic regions . The KIR2DL2/HLA-C1C1 pairing appeared more frequently in COVID-19 patients than in healthy individuals, suggesting people carrying this gene-ligand combination may be at higher risk for COVID-19. The inhibitory action of KIR2DL2 on NK cell activation likely prevents early clearance of SARS-CoV-2, allowing the virus to establish infection . Importantly, the protective effect of KIR2DL3/HLA-C1 pairing was found to be dependent on the absence of KIR2DL2, further emphasizing KIR2DL2's role in COVID-19 susceptibility.

What is known about KIR2DL2's role in herpesvirus infections and reactivation?

KIR2DL2 expression increases susceptibility to herpesvirus infections, particularly in patients with certain conditions like multiple sclerosis (MS). Studies have shown that MS patients expressing KIR2DL2 on NK cells demonstrate increased susceptibility to human herpesvirus (HHV) infections, especially EBV and HHV-6 . The receptor/ligand pair KIR2DL2/HLA-C1 has been identified as a predisposing factor for HSV-1 infection and reactivation. In MS patients, NK cells expressing KIR2DL2 show reduced activation against HHV infection compared to control subjects . Studies reported the highest HHV-6 viral load in MS patients with KIR2DL2 expression, accompanied by increased percentages of subjects positive for IgG against HHV-6 in KIR2DL2-positive MS patients compared to controls . This suggests that KIR2DL2 plays a significant role in controlling herpesvirus latency and reactivation.

How does KIR2DL2 affect HCV infection outcomes?

KIR2DL2 has been associated with both HCV infection rates and viral clearance. Previous research has found that the presence of KIR2DL2 inhibits the NK cell response to HCV-infected patients in the Chinese Han population . As KIR2DL2 combines more strongly with HLA-C than KIR2DL3, it may exert a more powerful inhibitory effect on NK cells that promotes survival of the virus. The stronger inhibitory signal from KIR2DL2 likely compromises the ability of NK cells to efficiently eliminate HCV-infected hepatocytes during early infection. This reduced early antiviral response allows the virus to establish a foothold in the host, potentially leading to chronic infection . The relationship between KIR2DL2 and HCV underscores the critical role of NK cell inhibitory receptors in determining viral infection outcomes.

What is the relationship between KIR2DL2 and multiple sclerosis?

Research has established a connection between KIR2DL2 expression and increased susceptibility to multiple sclerosis (MS), particularly in relation to viral infections. Studies show that MS patients expressing KIR2DL2 on NK cells demonstrate greater susceptibility to human herpesvirus (HHV) infections, especially EBV and HHV-6 . The mechanism appears to involve decreased NK cell activation against viral infections in KIR2DL2-positive MS patients, whereas control subjects with KIR2DL2 show no such deficiency in NK cell activation. This suggests that the KIR2DL2 receptor creates a unique immunological environment in MS patients that favors viral persistence. Researchers hypothesize that herpesvirus reactivation, potentially through molecular mimicry mechanisms, may induce autoimmunity, tissue damage, and subsequent MS lesion development . The presence of viral infections may thus serve as a triggering factor for autoimmune responses in genetically susceptible individuals.

How does the KIR2DL2/HLA-C1 interaction influence autoimmune disease development?

The interaction between KIR2DL2 and its primary ligand HLA-C1 creates an immunological environment that may predispose individuals to autoimmune conditions. In multiple sclerosis patients, the KIR2DL2/HLA-C1 receptor-ligand pair has been associated with increased susceptibility to herpesvirus infections, which may trigger or exacerbate autoimmunity . The frequency distribution of KIR2DL2 and HLA-C1/C2 genotypes varies significantly between patients with autoimmune conditions and healthy controls. For instance, one study found that the C1/C2 HLA genotype was significantly more common in MS patients (46%) compared to healthy controls (25%) and patients with other inflammatory neurological diseases (23%), with a p-value of 9.9 × 10^-4 . This suggests that the specific combination of KIR receptors and HLA ligands shapes the NK cell repertoire and functional responses in ways that may predispose to autoimmunity.

What inflammatory markers are associated with KIR2DL2-positive multiple sclerosis patients?

KIR2DL2-positive MS patients exhibit distinct inflammatory cytokine profiles compared to both healthy controls and patients with other inflammatory neurological diseases (OIND). Studies have shown that MS and OIND patients have higher levels of several key cytokines compared to control subjects, including IL-8, IL-12p70, IL-10, and TNF-alpha . While MS and OIND patients showed similar levels of IL-8, MS patients presented notably higher IL-12p70, TNF-alpha, and IL-10 levels compared to OIND patients . This cytokine profile suggests a unique inflammatory environment in MS patients that may be influenced by KIR2DL2 expression. The elevated pro-inflammatory cytokines (IL-12p70, TNF-alpha) alongside increased anti-inflammatory IL-10 indicates a complex dysregulation of immune responses rather than simple inflammation. This cytokine signature may reflect ongoing viral-induced immune activation that contributes to autoimmune pathology in KIR2DL2-positive MS patients.

How can researchers effectively study the functional differences between KIR2DL2 and KIR2DS2?

Studying the functional differences between the inhibitory KIR2DL2 and activating KIR2DS2 receptors requires specialized approaches due to their high structural homology. An effective methodology involves:

  • Initial separation of NK cell populations using flow cytometry with antibodies that recognize both receptors

  • Subsequent genetic confirmation through RT-PCR specifically targeting KIR2DL2

  • Cloning of NK cells to generate pure populations expressing different KIR receptor combinations

  • Functional assays using target cells expressing different HLA-C ligands to assess:

    • Degranulation responses (measured by CD107a expression)

    • Cytokine production

    • Proliferative capacity

Research has shown that when KIR2DS2 and KIR2DL2 are coexpressed, NK cell inhibition via KIR2DL2 overrides NK cell activation via KIR2DS2 . Conversely, KIR2DL1 and KIR2DS2 demonstrate an additive enhancing effect on NK cell responses against C1C1 target cells . These complex interactions highlight the importance of studying receptor co-expression patterns when evaluating functional outcomes.

What experimental models are optimal for studying KIR2DL2's role in viral infections?

For studying KIR2DL2's role in viral infections, researchers should consider several complementary experimental models:

  • Primary human NK cell isolation: Isolating NK cells from KIR-genotyped donors with different KIR2DL2/HLA-C combinations provides physiologically relevant material. Studies have shown that sorting KIR2DL2+ NK cells and evaluating their responses to virus-infected cells offers insights into inhibitory mechanisms .

  • In vitro viral infection systems: These should include:

    • Target cells with defined HLA-C genotypes (C1/C1, C1/C2, C2/C2)

    • Viral infection models using relevant viruses (HHV-6, EBV, SARS-CoV-2, HCV)

    • Functional readouts including cytotoxicity assays, degranulation (CD107a), and cytokine production

  • Humanized mouse models: These allow in vivo assessment of KIR2DL2's impact on viral clearance and persistence.

  • Clinical correlation studies: Examining the relationship between KIR2DL2 genotype, viral load, and clinical outcomes in patient cohorts.

Research has demonstrated that NK cells from MS patients expressing KIR2DL2 show decreased activation against herpesvirus-infected cells compared to control subjects , highlighting the importance of studying both healthy and disease contexts. Comprehensive experimental design should include appropriate controls, such as comparing KIR2DL2+ with KIR2DL2- NK cells from the same individual when possible, and accounting for HLA-C genotype variations.

How do KIR2DL2 and KIR2DS2 cooperatively shape the NK cell repertoire?

KIR2DL2 and KIR2DS2 exert significant influence on the NK cell receptor repertoire through complex interactions with other KIR molecules and their ligands. Research shows that KIR2DL2/3/S2 NK cells predominate within the KIR repertoire in KIR2DL2/S2+ individuals, while the KIR2DL1/S1 NK cell compartment dominates in C2C2 KIR2DL2/S2- individuals . These distribution patterns suggest that the repertoire formation is influenced by the presence of both inhibitory and activating KIRs.

Studies indicate that alongside KIR2DL2, the expression of activating receptors KIR2DS1 and KIR2DS2 limits KIR2DL1 acquisition on NK cells . In KIR2DL1-negative individuals, KIR2DL2/3/2DS2 expression significantly increases compared to KIR2DL1-positive counterparts, suggesting an adjustment mechanism in repertoire formation. This challenges the notion of sequential KIR acquisition with KIR2DL1 expression following KIR2DL2/KIR2DL3, and instead supports a continuous adjustment model where KIR2D expression recalibrates according to other expressed KIR2D receptors .

What is the mechanistic basis for the differential binding affinities of KIR2DL2 and KIR2DL3 to HLA-C?

The differential binding affinities of KIR2DL2 and KIR2DL3 to HLA-C molecules stem from subtle structural differences that significantly impact receptor-ligand interactions. KIR2DL2 combines more strongly with HLA-C than KIR2DL3, enabling it to exert more powerful inhibitory effects on NK cells . While both receptors recognize HLA-C molecules of the C1 group, KIR2DL2 also demonstrates weaker affinity for C2 ligands with the N77K80 motif .

These binding differences likely result from amino acid variations in the extracellular domains that create distinct interaction surfaces. The stronger binding of KIR2DL2 may explain why KIR2DL2+ individuals show increased susceptibility to certain viral infections—the more potent inhibitory signal might prevent effective viral clearance by NK cells during early infection. Understanding these structural and functional differences requires advanced techniques such as protein crystallography, surface plasmon resonance, and molecular dynamics simulations to characterize the precise molecular interactions that govern binding affinity and functional outcomes.

What are the potential therapeutic implications of targeting the KIR2DL2/HLA-C interaction in viral infections and autoimmune diseases?

Targeting the KIR2DL2/HLA-C interaction represents a promising therapeutic strategy for both viral infections and autoimmune diseases. For viral infections like COVID-19 and HCV, where KIR2DL2 expression correlates with increased susceptibility , blocking this inhibitory receptor could enhance NK cell activity and improve viral clearance. Conversely, in autoimmune conditions like multiple sclerosis, where KIR2DL2-positive patients show increased susceptibility to herpesvirus infections that may trigger or exacerbate disease , a dual approach might be needed.

Potential therapeutic approaches include:

  • Blocking antibodies: Monoclonal antibodies specifically targeting KIR2DL2 to prevent inhibitory signaling and enhance NK cell activation against viruses

  • Peptide inhibitors: Small molecules designed to disrupt KIR2DL2/HLA-C1 binding

  • Combined antiviral/immunomodulatory strategies: In autoimmune conditions, simultaneously targeting herpesvirus infections while modulating the KIR2DL2-mediated NK cell response

  • Personalized approaches: Tailoring treatments based on individual KIR/HLA genotypes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.