Recombinant Human Killer cell lectin-like receptor subfamily G member 2 (KLRG2)

Shipped with Ice Packs
In Stock

Description

General Information

Killer cell lectin-like receptor subfamily G member 2 (KLRG2) is a protein-coding gene . KLRG2 is also known as CLEC15B and FLJ44186 . Genetic variants in KLRG2 may influence the Gleason score at diagnosis and, therefore, the aggressiveness of prostate cancer .

Gene Ontology (GO) Annotations

Gene Ontology (GO) annotations related to KLRG2 include carbohydrate binding .

Expression in Human Tissue

Estimation of protein expression in human tissue could not be performed .

Role in Lung Adenocarcinoma (LUAD)

KLRG2 is identified as one of the genes that could serve as independent prognostic indicators in lung adenocarcinoma (LUAD) . Studies have constructed predictive risk models and identified pyroptosis subtype-related gene expression patterns to improve the prognosis of LUAD, where KLRG2 is a key component .

  • Prognostic Significance Survival analysis indicates that risk models incorporating KLRG2 effectively predict prognosis in LUAD .

  • Correlation Analysis Correlation analysis has been performed to explore the relationships between KLRG2, clinicopathological variables, and immune cell infiltration levels in LUAD .

Immune-Related Mechanisms

  • Immune Cell Infiltration The correlation between KLRG2 expression level and immune cell infiltration level has been explored, along with the correlation between somatic copy number alterations (SCNA), mutation levels of KLRG2, and immune cell infiltration level .

Pyroptosis and KLRG2

KLRG2 is associated with pyroptosis, a form of programmed cell death, in the context of LUAD .

  • Risk Model KLRG2 is used alongside other genes like C6, MAPK4, and SFRP5 to construct risk models for predicting LUAD prognosis .

  • Functional Enrichment Analysis Functional enrichment analysis, including Gene Ontology (GO) and Kyoto Encyclopedia of Genes and Genomes (KEGG), predicts the function of target genes and systematic signaling pathways related to KLRG2 .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
KLRG2; CLEC15B; Killer cell lectin-like receptor subfamily G member 2; C-type lectin domain family 15 member B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-409
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
KLRG2
Target Protein Sequence
MEESWEAAPGGQAGAELPMEPVGSLVPTLEQPQVPAKVRQPEGPESSPSPAGAVEKAAGA GLEPSSKKKPPSPRPGSPRVPPLSLGYGVCPEPPSPGPALVKLPRNGEAPGAEPAPSAWA PMELQVDVRVKPVGAAGGSSTPSPRPSTRFLKVPVPESPAFSRHADPAHQLLLRAPSQGG TWGRRSPLAAARTESGCDAEGRASPAEGSAGSPGSPTCCRCKELGLEKEDAALLPRAGLD GDEKLPRAVTLTGLPMYVKSLYWALAFMAVLLAVSGVVIVVLASRAGARCQQCPPGWVLS EEHCYYFSAEAQAWEASQAFCSAYHATLPLLSHTQDFLGRYPVSRHSWVGAWRGPQGWHW IDEAPLPPQLLPEDGEDNLDINCGALEEGTLVAANCSTPRPWVCAKGTQ
Uniprot No.

Target Background

Gene References Into Functions
  1. Genetic variations in the KLRG2 gene may influence Gleason score at diagnosis and, consequently, prostate cancer aggressiveness. PMID: 20945404
  2. Observational study of gene-disease association (HuGE Navigator). PMID: 20945404
Database Links

HGNC: 24778

KEGG: hsa:346689

STRING: 9606.ENSP00000339356

UniGene: Hs.17572

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is KLRG2 and what are its key structural features?

KLRG2 (Killer Cell Lectin Like Receptor G2) is a protein-coding gene located on chromosome 7 in humans. It encodes a C-type lectin receptor that is predicted to be an integral component of the cell membrane with carbohydrate binding capabilities . The protein contains characteristic C-type lectin domains that are crucial for its binding functions. Structurally, it shares features with other members of the killer cell lectin-like receptor family but has distinct characteristics that differentiate it from related proteins such as its paralog CLEC2L .

What are the common aliases and identifiers for KLRG2?

KLRG2 is known by several aliases in scientific literature and databases:

  • Killer Cell Lectin Like Receptor G2 (primary name)

  • CLEC15B

  • Killer Cell Lectin-Like Receptor Subfamily G, Member 2

  • Killer Cell Lectin-Like Receptor Subfamily G Member 2

  • C-Type Lectin Domain Family 15 Member B

  • FLJ44186

  • C-Type Lectin Domain Family 15, Member B

The gene has the following database identifiers:

  • HGNC: 24778

  • NCBI Gene ID: 346689

  • Ensembl: ENSG00000188883

  • UniProtKB/Swiss-Prot: A4D1S0

What are the predicted cellular functions of KLRG2?

Based on Gene Ontology (GO) annotations, KLRG2 is predicted to enable carbohydrate binding activity and function as an integral component of the cell membrane . While its precise role is still being investigated, as a member of the C-type lectin receptor family, it likely participates in cellular recognition processes, potentially including immune cell interactions with target cells or pathogens. Its structural similarity to other killer cell lectin-like receptors suggests it may have immunoregulatory functions, possibly in natural killer cells or other immune cell populations.

What expression systems are most effective for producing recombinant KLRG2?

For recombinant KLRG2 production, researchers commonly employ several expression systems, each with unique advantages:

Expression SystemAdvantagesConsiderations
Mammalian (HEK293, CHO)Proper post-translational modifications; native-like folding; higher likelihood of functional proteinHigher cost; longer production time; lower yield
Bacterial (E. coli)High yield; cost-effective; rapid productionLimited post-translational modifications; refolding often required; potential endotoxin contamination
Insect (Sf9, Hi5)Moderate yield; some post-translational modificationsIntermediate cost; glycosylation patterns differ from mammals
Yeast (P. pastoris)Higher yield than mammalian; some post-translational modificationsHyperglycosylation may affect function; optimization required

When selecting an expression system, consider the downstream application requirements. For structural studies requiring large quantities, bacterial or yeast systems may be preferred despite potential folding challenges. For functional assays, mammalian expression systems typically produce more naturally folded protein with appropriate post-translational modifications essential for lectin activity.

What purification strategies yield the highest purity and activity of recombinant KLRG2?

Purification of recombinant KLRG2 typically involves a multi-step process to ensure high purity while maintaining biological activity:

  • Initial Capture: Affinity chromatography using either:

    • Ni-NTA for His-tagged KLRG2

    • Anti-FLAG for FLAG-tagged constructs

    • Lectin affinity columns exploiting KLRG2's carbohydrate-binding properties

  • Intermediate Purification:

    • Ion exchange chromatography (typically anion exchange at pH 7.5-8.0)

    • Hydrophobic interaction chromatography

  • Polishing Step:

    • Size exclusion chromatography to separate monomeric from aggregated protein

    • Removal of endotoxin (critical for functional studies)

Throughout purification, it's essential to maintain conditions that preserve the carbohydrate-binding activity of KLRG2, including appropriate calcium concentrations (typically 1-2 mM CaCl₂) in all buffers, as C-type lectins are calcium-dependent binding proteins.

How can researchers validate the functional activity of purified recombinant KLRG2?

Functional validation of recombinant KLRG2 should employ multiple complementary approaches:

  • Binding Assays:

    • Solid-phase binding assays using potential glycan ligands

    • Surface plasmon resonance (SPR) to determine binding kinetics

    • Glycan array screening to identify specific carbohydrate recognition patterns

  • Cellular Assays:

    • Flow cytometry to assess binding to potential target cells

    • Cell adhesion assays to evaluate KLRG2-mediated intercellular interactions

    • Reporter cell assays to detect downstream signaling activation

  • Structural Integrity Assessment:

    • Circular dichroism to confirm proper protein folding

    • Thermal shift assays to evaluate protein stability

    • Limited proteolysis to assess domain organization

Each validation approach provides distinct information about KLRG2 functionality, and combining multiple methods creates a more comprehensive understanding of the protein's activity profile.

How does KLRG2 expression vary across different immune cell populations?

KLRG2 expression patterns across immune cell subsets remain an active area of investigation. Based on current understanding of C-type lectin receptors:

Immune Cell TypeKLRG2 Expression PatternFunctional Implications
Natural Killer CellsVariable expression; potentially subset-specificMay regulate cytotoxicity and target cell recognition
T LymphocytesLikely on specific subsets; may be activation-dependentPotential role in T cell differentiation or effector function
Myeloid CellsExpression on specific subsets requires investigationPossible role in antigen presentation or pathogen recognition
B CellsLimited expression expectedFunction unclear if expressed

Single-cell RNA sequencing approaches are particularly valuable for defining cell type-specific expression patterns. When investigating KLRG2 expression, researchers should employ multiple detection methods (RNA-seq, flow cytometry, immunohistochemistry) to comprehensively characterize expression across immune populations in different activation states and tissue contexts.

How might KLRG2 interact with the type I interferon response pathway?

Based on patterns observed with other immune receptors, KLRG2 may have complex interactions with the type I interferon signaling pathway. Research in related systems has demonstrated negative associations between stemness and type I interferon signaling , suggesting potential regulatory relationships between cell differentiation state and interferon responses.

To investigate KLRG2-interferon interactions, researchers should consider:

  • Expression Correlation Analysis:

    • Examine whether KLRG2 expression changes in response to type I interferons

    • Analyze whether IFN-α/β signaling components are differentially expressed in KLRG2+ versus KLRG2- cells

  • Functional Interference Studies:

    • Assess whether KLRG2 engagement modulates STAT1/2 phosphorylation

    • Determine if KLRG2 signaling affects interferon-stimulated gene (ISG) expression

  • Mechanistic Investigations:

    • Identify potential binding partners that could connect KLRG2 signaling to interferon pathway components

    • Examine whether KLRG2 co-localizes with interferon receptors or downstream signaling molecules

These approaches would help elucidate whether KLRG2 functions as a positive or negative regulator of interferon responses, potentially revealing new immunoregulatory mechanisms.

How can researchers address heterogeneity in KLRG2 expression data across different experimental models?

Heterogeneity in KLRG2 expression data across experimental models presents significant challenges for researchers. To address this heterogeneity effectively:

  • Standardize Detection Methods:

    • Establish validated antibody clones and RNA probes for consistent detection

    • Implement standardized protocols across laboratories with appropriate controls

    • Use recombinant KLRG2 standards for quantitative assays

  • Account for Biological Variables:

    • Document and control for cell activation status, which may dramatically affect expression

    • Consider tissue-specific microenvironmental factors that influence expression

    • Address potential species differences when comparing human and model organism data

  • Statistical Approaches:

    • Employ mixed-effects models to account for inter-experimental variation

    • Use Bayesian hierarchical modeling to integrate data from diverse sources

    • Conduct meta-analyses with random effects to synthesize findings across studies

  • Data Visualization:

    • Represent heterogeneity explicitly in visualizations rather than relying solely on averages

    • Use dimensionality reduction techniques to identify patterns across heterogeneous datasets

    • Implement interactive visualization tools that allow exploration of multiple variables

By addressing heterogeneity methodically, researchers can develop more robust and reproducible findings regarding KLRG2 biology.

What bioinformatic approaches are most effective for studying KLRG2 in large genomic and transcriptomic datasets?

For effective analysis of KLRG2 in large-scale genomic and transcriptomic datasets, researchers should implement a multi-layered bioinformatic approach:

  • Co-expression Network Analysis:

    • Weighted gene correlation network analysis (WGCNA) to identify gene modules co-regulated with KLRG2

    • Bayesian network inference to predict causal relationships between KLRG2 and other genes

  • Integration with Functional Annotations:

    • Gene set enrichment analysis (GSEA) to identify biological processes associated with KLRG2 expression patterns

    • Pathway analysis using KEGG, Reactome, or other pathway databases to place KLRG2 in functional contexts

  • Multi-omics Integration:

    • Parallel analysis of genomic, transcriptomic, and proteomic data to understand regulation of KLRG2

    • Use of multi-omics factor analysis (MOFA) or similar approaches to identify factors driving KLRG2 expression

  • Comparative Analysis Across Datasets:

    • Meta-analysis approaches like combining effect sizes or p-values across multiple datasets

    • Transfer learning approaches to leverage patterns identified in large datasets when analyzing smaller cohorts

These approaches should be implemented with rigorous quality control and sensitivity analyses to ensure robust findings, particularly when dealing with heterogeneous datasets from different sources or platforms.

How should researchers interpret contradictory findings about KLRG2 function in different experimental contexts?

Contradictory findings about KLRG2 function across different experimental contexts are common challenges in receptor biology research. To interpret and reconcile such contradictions:

  • Systematic Contextualization:

    • Create a comprehensive table categorizing findings by experimental system, cell type, activation state, and detection method

    • Identify patterns in contradictions (e.g., differences between in vitro and in vivo systems)

    • Determine whether contradictions reflect true biological complexity or methodological differences

  • Methodological Examination:

    • Critically evaluate the specificity of reagents used across studies

    • Compare protein expression levels in different systems, as receptor density can dramatically alter function

    • Assess whether post-translational modifications differ between experimental systems

  • Hypothesis Generation for Reconciliation:

    • Develop testable hypotheses that could explain apparent contradictions

    • Design experiments specifically to test whether contextual factors explain divergent results

    • Consider receptor oligomerization, co-receptor involvement, or signaling thresholds as potential explanations

  • Collaborative Resolution:

    • Establish collaborations between labs reporting contradictory findings to directly compare methods

    • Develop standard operating procedures that multiple laboratories can implement for validation

    • Create shared resources (cell lines, reagents, protocols) to reduce technical variability

By systematically addressing contradictions rather than dismissing them, researchers can often uncover important biological principles about context-dependent receptor function.

What emerging technologies will advance our understanding of KLRG2 biology?

Several cutting-edge technologies show particular promise for advancing KLRG2 research:

  • Advanced Imaging Technologies:

    • Super-resolution microscopy to visualize KLRG2 distribution and clustering on cell membranes

    • Lattice light sheet microscopy for long-term live imaging of KLRG2-mediated cellular interactions

    • Correlative light and electron microscopy (CLEM) to connect KLRG2 function to ultrastructural features

  • Protein Engineering and Screening:

    • Directed evolution approaches to generate KLRG2 variants with altered binding properties

    • Proximity labeling techniques (BioID, APEX) to identify the KLRG2 protein interactome

    • CRISPR activation/interference screens to identify genes regulating KLRG2 expression and function

  • Single-Cell and Spatial Technologies:

    • Single-cell proteogenomics to correlate KLRG2 expression with cellular states

    • Spatial transcriptomics to map KLRG2 expression in tissue microenvironments

    • Mass cytometry imaging to simultaneously visualize KLRG2 and dozens of other markers

  • Computational Biology Approaches:

    • Machine learning algorithms to predict KLRG2 binding partners based on glycan structures

    • Molecular dynamics simulations to model KLRG2 interactions at atomic resolution

    • Systems biology modeling of KLRG2-involved signaling networks

These technologies, particularly when combined in integrative approaches, will provide unprecedented insights into KLRG2 biology.

What are the key unanswered questions about KLRG2 that researchers should prioritize?

Despite advances in understanding C-type lectin receptors, several critical questions about KLRG2 remain unanswered and warrant prioritization:

  • Ligand Identification and Specificity:

    • What are the natural ligands for KLRG2?

    • How does the glycan recognition profile of KLRG2 compare to other C-type lectin receptors?

    • Are KLRG2 ligands differentially expressed in disease states?

  • Signaling Mechanisms:

    • What intracellular signaling pathways are activated upon KLRG2 engagement?

    • Does KLRG2 function as an activating or inhibitory receptor, or is its function context-dependent?

    • What adaptor molecules associate with KLRG2 to transduce signals?

  • Physiological Function:

    • What is the role of KLRG2 in normal immune development and homeostasis?

    • How does KLRG2 contribute to pathogen recognition or clearance?

    • Does KLRG2 function change during aging or in response to chronic inflammation?

  • Disease Relevance:

    • Is KLRG2 expression or function altered in autoimmune diseases, cancer, or infectious diseases?

    • Could KLRG2 serve as a therapeutic target for modulating immune responses?

    • Do naturally occurring KLRG2 polymorphisms associate with disease susceptibility?

Addressing these questions requires multidisciplinary approaches combining structural biology, glycobiology, cellular immunology, and systems biology.

How might KLRG2 research inform the development of novel immunotherapeutic approaches?

KLRG2 research could lead to several innovative immunotherapeutic strategies:

  • Targeted Immune Modulation:

    • If KLRG2 functions as an inhibitory receptor like some immune checkpoint molecules (e.g., CD276/B7-H3) , blocking antibodies could potentially enhance anti-tumor immunity

    • Conversely, if KLRG2 is activating, agonistic antibodies might boost immune responses against pathogens

    • Bispecific antibodies linking KLRG2 to tumor antigens could redirect immune cells to target cancer cells

  • Cell Therapy Enhancement:

    • Genetic modification of CAR-T cells to express or silence KLRG2 might alter their persistence or function

    • KLRG2 expression could serve as a selection marker for adoptive cell therapy, identifying cells with particular functional properties

    • Targeting KLRG2+ cells for expansion ex vivo could generate specialized therapeutic cell populations

  • Diagnostic and Prognostic Applications:

    • KLRG2 expression patterns might serve as biomarkers for patient stratification

    • Monitoring KLRG2+ immune populations could provide insights into treatment response

    • Imaging KLRG2 in vivo might enable visualization of specific immune cell populations

  • Glycan-Based Therapeutics:

    • Synthetic KLRG2 ligands could be developed to modulate immune responses

    • Nanoparticles decorated with KLRG2 ligands could target specific immune cell populations

    • Glycoengineering of therapeutic antibodies could enhance or inhibit KLRG2 recognition

Development of these approaches requires thorough characterization of KLRG2 biology and careful validation in preclinical models before clinical translation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.