Recombinant Human Kinocilin (KNCN)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Kinocilin (KNCN)

Recombinant Human Kinocilin (KNCN), also known as kinocilin, is a protein that has been studied for its potential roles in various biological processes. Despite its relatively recent emergence in scientific literature, KNCN has garnered interest due to its unique characteristics and potential applications in research and medicine. This article aims to provide a comprehensive overview of Recombinant Human Kinocilin (KNCN), including its definition, research findings, and potential applications.

Definition and Structure

Kinocilin is encoded by the gene symbol KNCN, which is also known as Kino or L5. The gene ID for KNCN is 148930, and its ORF size is approximately 228 bp . The protein structure and function of KNCN are not extensively detailed in current literature, suggesting a need for further research to understand its biological roles.

Potential Applications

While specific applications of Recombinant Human Kinocilin (KNCN) are not well-documented, its availability in recombinant form and as part of over-expression systems suggests potential uses in:

  • Basic Research: Studying the biological functions of KNCN in cell culture models.

  • Gene Therapy: Using AAV vectors to introduce KNCN into cells for therapeutic purposes.

  • Protein-Protein Interaction Studies: Investigating how KNCN interacts with other proteins to understand its role in cellular processes.

Data and Tables

Given the limited specific data available on Recombinant Human Kinocilin (KNCN), the following table summarizes general information about the protein and its resources:

CategoryDescription
Gene SymbolKNCN
Gene Namekinocilin
Gene ID148930
ORF Size228 bp
RefSeq#BC101295
HGNC IDHGNC:26488
Vector AvailabilityAAV vectors for over-expression

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
KNCN; Kinocilin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-124
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
KNCN
Target Protein Sequence
MDIPISSRDFRGLQLACVALGLVAGSIIIGISVSKAAAAMGGVFIGAAVLGLLILAYPFL KARFNLDHILPTIGSLRIHPHPGADHGEGRSSTNGNKEGARSSLSTVSRTLEKLKPGTRG AEEC
Uniprot No.

Target Background

Function

Kinocilin may play a role in stabilizing dense microtubular networks and/or in vesicular trafficking.

Database Links

HGNC: 26488

OMIM: 611455

KEGG: hsa:148930

UniGene: Hs.350764

Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.