Recombinant Human KiSS-1 receptor (KISS1R)

Shipped with Ice Packs
In Stock

Description

Reproductive Endocrinology

KISS1R is pivotal in regulating the hypothalamic-pituitary-gonadal (HPG) axis:

  • Puberty Onset: Activates gonadotropin-releasing hormone (GnRH) neurons to initiate puberty .

  • Gonadal Function: Modulates ovarian follicle development and testosterone production in testes .

  • Placental Regulation: Controls trophoblast invasion during pregnancy .

Cancer Biology

KISS1R exhibits context-dependent roles in oncology:

Cancer TypeRole of KISS1RMechanism
Triple-Negative Breast Cancer (TNBC)Promotes chemoresistance and invasion via AXL/BCRP signaling Upregulates drug efflux pumps (BCRP) and receptor tyrosine kinase AXL .
Prostate CancerDownregulated in advanced stages; loss correlates with metastasis Suppresses tumor progression via MMP-9 inhibition .
Multiple MyelomaServes as a biomarker for tumor microenvironment imaging Binds fluorescently labeled kisspeptin for in vivo detection .

Antibodies and Assays

  • KISS1R (D9D7C) Rabbit mAb #13776: Validated for Western blot (40–140 kDa band) and immunoprecipitation .

  • KISS1 Metastasis-Suppressor Recombinant Protein: Used to study kisspeptin-KISS1R interactions in metastasis .

Expression Systems

Recombinant KISS1R is typically expressed in mammalian cell lines (e.g., HEK293) to preserve post-translational modifications and ligand-binding efficacy .

Oncological Studies

  • TNBC:

    • KISS1R overexpression correlates with poor prognosis and drug resistance .

    • Fibulin-3 acts as a downstream mediator, enhancing MMP-9 activity and metastasis .

ParameterTNBC (High KISS1R)Non-TNBC (Low KISS1R)p-Value
Tumor SizeLargerSmaller0.077
Lymph Node PositivityHigherLower0.056
Disease-Free SurvivalShorterLonger0.092

Data derived from immunohistochemical H-scores in African American women .

Therapeutic Targeting

  • KISS1R Antagonists: Restore chemosensitivity in TNBC by inhibiting BCRP and AXL .

  • Kisspeptin Agonists: Potential for treating reproductive disorders like hypogonadotropic hypogonadism .

Challenges and Future Directions

  • Dual Roles in Cancer: KISS1R suppresses metastasis in melanoma and prostate cancer but promotes invasion in TNBC .

  • Biomarker Validation: Plasma fibulin-3 levels in TNBC patients require large-scale clinical trials for diagnostic utility .

  • Structural Studies: Cryo-EM data of KISS1R-kisspeptin complexes are needed to design targeted therapies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, specific format requests should be noted during order placement for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are standardly shipped with blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please specify it; we will prioritize its development.
Synonyms
KISS1R; AXOR12; GPR54; KiSS-1 receptor; KiSS-1R; G-protein coupled receptor 54; G-protein coupled receptor OT7T175; hOT7T175; Hypogonadotropin-1; Kisspeptins receptor; Metastin receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-398
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MHTVATSGPNASWGAPANASGCPGCGANASDGPVPSPRAVDAWLVPLFFAALMLLGLVGN SLVIYVICRHKPMRTVTNFYIANLAATDVTFLLCCVPFTALLYPLPGWVLGDFMCKFVNY IQQVSVQATCATLTAMSVDRWYVTVFPLRALHRRTPRLALAVSLSIWVGSAAVSAPVLAL HRLSPGPRAYCSEAFPSRALERAFALYNLLALYLLPLLATCACYAAMLRHLGRVAVRPAP ADSALQGQVLAERAGAVRAKVSRLVAAVVLLFAACWGPIQLFLVLQALGPAGSWHPRSYA AYALKTWAHCMSYSNSALNPLLYAFLGSHFRQAFRRVCPCAPRRPRRPRRPGPSDPAAPH AELLRLGSHPAPARAQKPGSSGLAARGLCVLGEDNAPL
Uniprot No.

Target Background

Function
The Kisspeptin receptor (KISS1R) is a G protein-coupled receptor for metastin (kisspeptin-54 or kp-54), a C-terminally amidated peptide derived from KiSS1. KiSS1, a metastasis suppressor protein, inhibits metastasis in malignant melanomas and some breast carcinomas without impacting tumorigenicity. This metastasis suppression may be partially mediated by cell cycle arrest and apoptosis induction in malignant cells. KISS1R is crucial for normal gonadotropin-releasing hormone (GnRH) physiology and puberty. The hypothalamic KiSS1/KISS1R system plays a central role in regulating the gonadotropic axis during puberty and adulthood. Furthermore, KISS1R likely regulates trophoblast invasion. Signal transduction studies reveal coupling to phospholipase C and intracellular calcium release via pertussis toxin-insensitive G(q) proteins.
Gene References Into Functions
  1. KISS1R mutations account for only a small percentage of normosmic congenital hypogonadotrophic hypogonadism cases. PMID: 27094476
  2. Kisspeptin-10 may accelerate atheromatous plaque progression and instability, potentially leading to plaque rupture. GPR54 antagonists may offer therapeutic potential for atherosclerosis. PMID: 28411243
  3. The missense variant (c.1091T>A), causing the p.Leu364His substitution, was found more frequently in individuals with central precocious puberty. The haplotype CAGTGTC showed increased prevalence in this group.PMID: 27914139
  4. Metabolic and energy expenditure, but not feeding or glucose tolerance, are impaired in young Kiss1r knockout female mice. PMID: 27649089
  5. Neuropeptide derivatives, including Kisspeptin receptor (KISS1R) and neurokinin-3 receptor (NK3R) ligands, are being investigated for regulating the reproductive axis. PMID: 27271543
  6. In human cumulus granulosa cells, kiss1r mRNA levels correlated positively with age but not BMI. No kiss1 mRNA expression was detected in cumulus or mural granulosa cells. PMID: 26879207
  7. KISS1R signaling promotes invadopodia formation and activation of key invadopodia proteins, including cortactin, cofilin, and membrane type I matrix metalloproteases (MT1-MMP). PMID: 26721186
  8. Low KISS1R expression correlates with colorectal liver metastasis. PMID: 26471489
  9. KiSS1 functions as a metastasis suppressor gene in pancreatic cancer, independent of GPR54 expression levels. PMID: 26572251
  10. Mutations in KISS1 and KISS1R are not a frequent cause of idiopathic central precocious puberty (ICPP). PMID: 23950571
  11. Novel heterozygous missense mutations in FGFR1 and KISS1R were identified in Chinese Kallmann Syndrome males with cleft lip/palate. PMID: 26199944
  12. Most human non-functioning pituitary tumors express KISS1R, with lower expression rates in other pituitary tumor types. PMID: 24817066
  13. The GPR54 promoter is unmethylated in normal endometrium. PMID: 24908069
  14. Findings do not confirm a protective role of KiSS1/KiSS1R in breast cancer progression but support KiSS1/KiSS1R system activation in primary breast cancer and during lymph node invasion. PMID: 25535062
  15. A novel homozygous nonsense mutation (c.C969A, p.Y323X) in KISS1R causes normosmic idiopathic hypogonadotropic hypogonadism in three unrelated families. PMID: 25262569
  16. Numerous mutations in KISS1 and KISS1R are associated with central precocious puberty and isolated hypogonadotropic hypogonadism (review). PMID: 26510589
  17. No KISS1R expression was detected in normal or malignant tissues or liver metastases. PMID: 26010933
  18. Reduced Kiss-1R expression is linked to poor prognosis in colorectal cancer patients. PMID: 25260785
  19. Decreased KISS1R expression may attenuate KISS1/KISS1R signaling, potentially contributing to tumor growth. PMID: 25667462
  20. GPR54 and TACR3 gene mutations are not a frequent cause of ICPP. The identified synonymous SNP (rs10407968) in exon 1 is unlikely to affect exon splicing. PMID: 24434351
  21. Kisspeptin, GPR54, and PIBF expression in syncytiotrophoblasts and cytotrophoblasts were lower in women with recurrent spontaneous abortion compared to controls. PMID: 24225150
  22. Sustained calcium response to kisspeptin requires continuous extracellular ligand presence and involves dynamic KISS1R trafficking. PMID: 24295737
  23. High GPR54 expression is associated with breast cancer. PMID: 24596387
  24. Kiss-1 downregulation correlates with decreased Kiss-1R expression, which is inversely associated with clinical stage and tumor grade (review). PMID: 23969598
  25. Higher cumulative survival rates are observed in non-small cell lung cancer patients with KISS1 or KISS1R expression. KISS1 or KISS1R expression may indicate a favorable prognosis. PMID: 23716269
  26. Adding a PRR repeat to a proline-arginine-rich motif significantly alters the KISS1R intracellular domain conformation and its potential interactions with partner proteins. PMID: 23608644
  27. Kiss-1, Kiss-1R, and MMP9 expression is higher in the placenta compared to the placental bed and decidua parietalis. PMID: 23696833
  28. Mutations in kisspeptin and KISS1R are associated with idiopathic central precocious puberty, highlighting KISS1R signaling's importance for normal pubertal development. PMID: 23550005
  29. Structure, synthesis, and phylogeny of kisspeptin and its receptor. PMID: 23550000
  30. Kisspeptin neurons project to GnRH cell bodies (containing Kiss1r), and arcuate nucleus kisspeptin neurons also project to GnRH axons in the median eminence. PMID: 23550001
  31. Mammary cell ERalpha status influences whether KISS1R is a potential therapeutic target for breast cancer metastasis. PMID: 23525242
  32. A loss-of-function mutation (p.Tyr313His) in KISS1R causes familial congenital hypogonadotropic hypogonadism, revealing this amino acid's crucial role in KISS1R function. PMID: 23349759
  33. Negative metastin receptor expression in clear cell renal cell carcinoma is significantly associated with metastasis. PMID: 23277422
  34. Subnormal gonadal response to hCG may indicate a direct role of KISS1R in gonadal function and male external genitalia development. PMID: 22619348
  35. Increased kisspeptin receptor (KISS1R) expression in pre-eclampsia may reflect higher kisspeptin (KISS1) activity compared to normal pregnancy. PMID: 22526494
  36. NKB/NK(3)R and kisspeptin/KISS1R are found in female peripheral reproductive tissues, with colocalization in some non-neuronal cells of the human female genital tract. PMID: 22424618
  37. The KISS1/KISS1R system's role in endometriosis pathophysiology may be limited to a specific patient subset. PMID: 22210725
  38. Compared to Kiss-1 protein, GPR54 expression is primarily found in syncytiotrophoblasts and decidua, but not in cytotrophoblasts, in women with recurrent pregnancy loss. PMID: 21996032
  39. Kisspeptin and its receptor are expressed in the human, rat, and mouse heart, and kisspeptins exhibit potent positive inotropic activity. PMID: 22132116
  40. KISS1R undergoes proteasomal degradation, unlike the lysosomal degradation typical of most G protein-coupled receptors. PMID: 21912371
  41. KISS1 and KISS1R expression in the human and rat carotid body and superior cervical ganglion. PMID: 22193294
  42. High GPR54 expression is associated with improved overall survival in endometrial cancer and correlates with known prognostic factors. PMID: 21282360
  43. This chapter reviews kisspeptin-GPR54 complex physiology and its role in human diseases. PMID: 20374724
  44. A novel loss-of-function mutation in GPR54 is associated with familial normosmic idiopathic hypogonadotropic hypogonadism. PMID: 21193544
  45. The Arg386Pro mutation does not affect KISS1R trafficking rate but prolongs kisspeptin responsiveness by reducing KISS1R degradation, increasing receptor recycling to the plasma membrane. PMID: 21285314
  46. KISS1 and KISS1R expression can be differentially lost in various pituitary tumor subtypes. PMID: 21169415
  47. A novel homozygous KISS1R mutation was identified in two siblings with normosmic isolated hypogonadotropic hypogonadism. PMID: 20371656
  48. Inactivating KISS1 receptor mutations cause isolated hypogonadotropic hypogonadism. PMID: 20237166
Database Links

HGNC: 4510

OMIM: 176400

KEGG: hsa:84634

STRING: 9606.ENSP00000234371

UniGene: Hs.208229

Involvement In Disease
Hypogonadotropic hypogonadism 8 with or without anosmia (HH8); Precocious puberty, central 1 (CPPB1)
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Most highly expressed in the pancreas, placenta and spinal cord, with lower-level of expression in peripheral blood leukocytes, kidney, lung, fetal liver, stomach, small intestine, testes, spleen, thymus, adrenal glands and lymph nodes. In the adult brain

Q&A

What is the relationship between the KISS1 gene, kisspeptins, and KISS1R?

The KISS1 gene encodes KISS1, a protein that is rapidly processed in serum into smaller biologically active peptides called kisspeptins (KPs). KISS1 and the KPs signal via the G-protein coupled receptor KISS1R. While initially recognized for regulating reproductive neuroendocrine functions, their first reported role was metastasis suppression in melanoma. These molecules now show context-dependent roles across various cancer types .

What are the primary signaling pathways activated by KISS1R?

KISS1R activation by kisspeptin stimulates phosphatidylinositol turnover and arachidonic acid release through activation of the mitogen-activated protein kinases and extracellular kinases 1/2 pathways. This signaling is critical for its biological functions in both normal physiology and pathological conditions . In experimental settings, total inositol phosphate production is often used as a marker of KISS1R signaling, with levels typically peaking after 2 hours of stimulation before declining as the receptor desensitizes .

How does KISS1R trafficking occur following ligand binding?

KISS1R undergoes time-dependent internalization upon kisspeptin stimulation, but importantly, most internalized receptors are recycled back to the membrane rather than degraded. Experimental tracking shows approximately 50% of receptors are internalized after 15 minutes of stimulation, and approximately 80% are internalized after 60 minutes, with only about 20% remaining on the cell surface . This dynamic recycling pattern, rather than degradation, explains the receptor's persistent membrane localization observed in confocal imaging studies.

How does KISS1R expression vary across different cancer types?

KISS1R shows remarkable context-dependent expression patterns across cancer types:

Cancer TypeKISS1/KISS1R Expression PatternClinical CorrelationReference
Liver (HCC)Overexpression (22% KISS1, 43% KISS1R)Disease progression & poor survival
PancreaticHigher in tumors vs. normal tissuePositive expression linked to longer survival
OvarianHigher in pre-operative tumorsLow expression associated with metastasis & shorter survival
BreastUpregulated in TNBC tumorsEnhanced expression at leading edge of migratory cells
Multiple MyelomaUpregulated on tumor cells and microenvironmentPotential imaging biomarker

Why does KISS1R function as both a tumor suppressor and promoter?

KISS1, KPs, and KISS1R represent a relatively rare group of molecules exhibiting dual roles in cancer. While they act as suppressors of tumorigenesis and metastasis in many cancers, they function as promoters in breast and liver cancer . This duality highlights the importance of studying cancer in context. The relationship between these molecules and a given cancer is complex and affected by multiple factors such as:

  • The specific microenvironment

  • Steroid receptor status of cancer cells

  • Stage of cancer progression

  • Tissue-specific signaling pathways

How does KISS1R expression change during cancer progression?

In several cancer types including pancreatic, ovarian, and colorectal cancer, researchers have observed that KISS1/KISS1R expression is high in early stages but progressively diminishes with cancer advancement . This pattern suggests a complex regulatory mechanism that changes during disease progression. For instance, in pancreatic cancer, tumors negative for both KP-54 and KISS1R expression were significantly larger than positive tumors, and KP-54 positive tumors showed less frequent recurrence .

What techniques are most effective for studying KISS1R trafficking?

Several complementary techniques have proven valuable for investigating KISS1R trafficking:

  • Radioligand binding assays: Using 125I-kisspeptin to track receptor internalization by measuring the relative distribution of receptors in membrane and intracellular fractions at specific time points .

  • Confocal microscopy: Employing fluorescently-tagged KISS1R (such as CFP-KISS1R) to visualize receptor localization and trafficking. This approach can detect colocalization with membrane markers (like Na+/K+ATPase) to confirm surface expression or internalization .

  • Surface biotinylation: Labeling surface proteins to distinguish between membrane-bound and internalized receptors.

  • Calcium flux assays: Measuring functional desensitization as an indirect measure of receptor trafficking.

How can researchers investigate KISS1R degradation mechanisms?

KISS1R degradation pathways can be studied through several approaches:

  • Proteasome vs. lysosome inhibition: Overnight treatment with proteasome inhibitors increases KISS1R protein levels by approximately 24-fold, while lysosome inhibitors show no effect, indicating proteasomal rather than lysosomal degradation .

  • Pulse-chase experiments: To track the fate of newly synthesized receptors.

  • Mutational analysis: Comparing degradation rates between wild-type and mutant receptors, such as the Arg386Pro mutant which shows decreased degradation and prolonged responsiveness to kisspeptin .

  • Colocalization studies: Using confocal imaging to assess receptor colocalization with proteasomal or lysosomal markers following stimulation.

What approaches are effective for studying KISS1R as a cancer biomarker?

For investigating KISS1R as a cancer biomarker, several approaches have proven valuable:

  • In vitro co-culture systems: Studying myeloma cells with mesenchymal stem cells (MSCs) has revealed KISS1R upregulation on MSCs when co-cultured with cancer cells .

  • Fluorescently-labeled kisspeptin: Conjugating kisspeptin with fluorescent dyes enables visualization of binding to both cancer cells and microenvironment components in vitro and in vivo .

  • In vivo imaging: Injecting conjugated kisspeptin into mice with myeloma bone lesions shows increased fluorescence in tumor-burdened limbs compared to controls, demonstrating potential as an imaging biomarker .

  • Quantitative PCR and immunohistochemistry: For measuring KISS1/KISS1R expression levels and localization patterns in clinical samples .

How does the Arg386Pro mutation affect KISS1R function?

The Arg386Pro mutation in KISS1R contributes to human central precocious puberty by prolonging receptor responsiveness to kisspeptin. Research has revealed that this mutation does not affect the rate of receptor trafficking (internalization or recycling); instead, it decreases receptor degradation . This results in a net increase of mutant receptors recycled back to the plasma membrane after stimulation. Key findings show:

  • Both wild-type and Arg386Pro mutant KISS1R internalize upon stimulation and mostly recycle back to the membrane

  • The mutation does not affect the relative distribution between membrane and internalized fractions

  • Total Arg386Pro KISS1R is substantially increased compared to wild-type after 120 minutes of kisspeptin stimulation

  • Blocking recycled receptor detection eliminates the increased responsiveness of the mutant

What is the significance of KISS1R in the tumor microenvironment?

KISS1R expression extends beyond cancer cells to include cells of the tumor microenvironment, offering unique research and therapeutic opportunities:

  • In multiple myeloma, KISS1R is upregulated on mesenchymal stem cells (MSCs) and osteoprogenitor cells (OPCs) when co-cultured with myeloma cells .

  • This expression pattern enables potential targeting of both malignant cells and the supporting microenvironment.

  • Beyond autocrine mechanisms, paracrine signaling between kisspeptin-expressing tumor cells and KISS1R-expressing stromal cells has been suggested .

  • This interaction is particularly relevant in myeloma where tumor-microenvironment interactions drive tumor progression and bone disease.

How does estrogen receptor signaling interact with KISS1/KISS1R expression?

Estrogen receptor signaling appears to negatively regulate KISS1/KISS1R expression in multiple contexts:

  • In breast cancer research, treatment of ERα-positive MCF7 and T47D cells with tamoxifen (a selective estrogen receptor modulator) stimulates KISS1/KISS1R expression .

  • This suggests that ERα signaling normally downregulates KISS/KISS1R levels in breast tissue.

  • This negative regulation by ERα is well-documented in ARC KISS1 neurons in the hypothalamus .

  • The relationship between ER status and KISS1/KISS1R expression helps explain observed differences in KISS1R function across breast cancer subtypes.

How can researchers interpret contradictory data on KISS1R in liver cancer?

Studies on KISS1/KISS1R in hepatocellular carcinoma (HCC) have produced contradictory findings that require careful interpretation:

  • Ikeguchi et al. showed KISS1 and KISS1R mRNA overexpression (22% and 43%, respectively) in HCC samples, positively associated with disease progression and poor survival .

  • Schmid et al. reported that elevated KP-54 expression correlated with worsened clinical outcomes in HCC patients who underwent liver transplantation .

  • In contrast, Shengbing et al. reported that KISS1 protein expression is lost in HCC, suggesting tumor suppressive roles, and found a negative association between KISS1 and MMP-9 .

These contradictions may reflect differences in:

  • Detection methods (mRNA vs. protein)

  • Sample timing (pre/post-treatment)

  • Disease subtypes or stages

  • Concurrent pathway activations

What methodological approaches can help resolve data inconsistencies?

To address contradictory findings in KISS1R research, consider these methodological approaches:

  • Comprehensive expression analysis: Measure both mRNA and protein levels simultaneously in the same samples.

  • Cell-specific analysis: Use techniques like single-cell RNA sequencing or laser capture microdissection to distinguish expression in cancer cells versus stromal cells.

  • Pathway activation assessment: Evaluate downstream signaling pathway activation alongside receptor expression.

  • Longitudinal sampling: Collect samples at multiple disease stages from the same patients when possible.

  • Standardized reporting: Include detailed patient characteristics, treatment history, and methodology descriptions to facilitate comparison across studies.

How can KISS1R be developed as a diagnostic imaging biomarker?

KISS1R shows promise as an imaging biomarker, particularly for cancers with significant microenvironment involvement:

  • In multiple myeloma, fluorescently-labeled kisspeptin binds to both myeloma cells and mesenchymal stem cells in co-culture .

  • In vivo studies show that conjugated kisspeptin injected into mice with myeloma bone lesions results in increased fluorescence in tumor-burdened limbs compared to controls .

  • Future research should focus on:

    • Optimizing kisspeptin conjugates for clinical imaging

    • Developing dual-targeting approaches to improve specificity

    • Exploring PET or SPECT tracers based on kisspeptin analogs

    • Correlating imaging findings with disease progression and treatment response

What therapeutic strategies could target the KISS1/KISS1R system?

Based on the dual role of KISS1/KISS1R in cancer, several therapeutic strategies merit investigation:

  • Cancer-specific modulation: Developing agonists for cancers where KISS1R acts as a suppressor, and antagonists where it functions as a promoter.

  • Targeted drug delivery: Using kisspeptin conjugates to deliver cytotoxic agents specifically to KISS1R-expressing tumors and their microenvironment.

  • Combination approaches: Pairing KISS1R modulators with inhibitors of downstream signaling pathways like PI3K/AKT and Ras/ERK, which are often dysregulated in carcinomas and linked to drug resistance .

  • Microenvironment targeting: Exploiting KISS1R expression on stromal cells to disrupt tumor-microenvironment interactions that promote cancer progression.

How might KISS1R signaling interact with drug resistance mechanisms?

Recent findings suggest important connections between KISS1R and drug resistance:

  • KISS1R signaling induces drug resistance in triple-negative breast cancer (TNBC) cells by upregulating the efflux drug transporter breast cancer resistance protein (ABCG2) .

  • KISS1R activation leads to increased expression and activation of the tyrosine kinase AXL, which is associated with drug resistance .

  • KISS1R engages with PI3K/AKT and Ras/ERK pathways, which are the most dysregulated signaling cascades in human carcinomas related to tumor drug resistance, survival, and proliferation .

  • Future research should investigate whether KISS1R inhibition could resensitize resistant tumors to conventional therapies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.