Recombinant Human L-selectin (SELL)

Shipped with Ice Packs
In Stock

Description

2.1. Leukocyte Adhesion and Migration

  • Tethering/Rolling: Mediates initial leukocyte-endothelial interactions via sialyl Lewis X (sLe<sup>x</sup>) glycans on endothelial cells .

  • Transendothelial Migration (TEM): Clusters with PECAM-1 during TEM, enhancing shedding via ADAM17 and accelerating migration .

  • Signaling: Cytoplasmic tail interactions with ERM proteins (ezrin/radixin/moesin) regulate cytoskeletal remodeling .

2.2. Pathological Relevance

  • Chronic Inflammation: Facilitates leukocyte recruitment in autoimmune diseases (e.g., rheumatoid arthritis) .

  • HIV-1 Infection: Acts as an adhesion receptor for HIV-1 gp120, promoting viral entry into CD4<sup>+</sup> T cells .

  • Sepsis and Thrombosis: Regulates neutrophil priming and tissue factor expression, impacting sepsis severity and venous thrombosis .

3.1. In Vitro Studies

  • Adhesion Assays: Used to model leukocyte-endothelial interactions under flow conditions .

  • Viral Entry Studies: HIV-1 binding assays with gp120-glycosylated envelopes .

  • Protein-Protein Interaction: FRET-based clustering studies with PECAM-1 .

3.2. Therapeutic Development

  • Drug Target: Investigated for blocking leukocyte recruitment in autoimmune disorders .

  • Biomarker: Soluble L-selectin levels correlate with Alzheimer’s disease progression and Treg cell activity .

Key Research Findings

Study FocusKey InsightSource
TEM RegulationL-selectin co-clusters with PECAM-1 during TEM, reducing migration time by 50% .
Neutrophil PrimingL-selectin mechanochemistry delays ROS release, balancing pathogen clearance and tissue damage .
HIV-1 AdhesionBinds HIV-1 gp120 with 50–300 nM affinity, enhancing viral entry .
Glycosylation ImpactHEK293-derived L-selectin shows higher ligand-binding activity than E. coli-derived versions .

Challenges and Limitations

  • Glycosylation Variability: HEK293/CHO-derived proteins exhibit cell-specific glycosylation, affecting functional consistency .

  • Shedding Artifacts: Spontaneous ectodomain shedding during experiments may skew results .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific requirements for the format, please indicate them in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
SELL; LNHR; LYAM1; L-selectin; CD62 antigen-like family member L; Leukocyte adhesion molecule 1; LAM-1; Leukocyte surface antigen Leu-8; Leukocyte-endothelial cell adhesion molecule 1; LECAM1; Lymph node homing receptor; TQ1; gp90-MEL; CD antigen CD62L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
39-372
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSKRSMNDPY
Uniprot No.

Target Background

Function
Calcium-dependent lectin that mediates cell adhesion by binding to glycoproteins on neighboring cells. It facilitates the adherence of lymphocytes to endothelial cells of high endothelial venules in peripheral lymph nodes. Furthermore, it promotes the initial tethering and rolling of leukocytes in endothelia.
Gene References Into Functions
  1. L-selectin (CD62L) has been identified as an HIV-1 adhesion receptor on CD4+ T cells. PMID: 30026537
  2. PI3K acts as a signal linker between L-selectin and PSGL-1 in IL-18 transcriptional activation at the promoter level. PMID: 29218606
  3. SELL expression remains unchanged in systemic sclerosis. PMID: 29356883
  4. Dual regulation of CD62L by HIV-1 has been reported, where Vpr enhances expression, while Nef and Vpu downregulate cell-surface expression. PMID: 30119013
  5. Recombinant human IL33 inhibits trophoblast invasion and adhesion, and decreases the expression of adhesion and invasion-associated molecules, such as integrin alpha4beta1 and CD62L. PMID: 28765940
  6. CD62L holds potential as a risk stratification marker in natalizumab treatment, as it is associated with progressive multifocal leukoencephalopathy. PMID: 26432858
  7. sLe(x) expressed on human L-selectin exhibits preferential binding to E-selectin. Upon ligation, it initiates the secretion of MRP8/14, which binds TLR4 to trigger the extension of beta2-integrin to an intermediate affinity state. PMID: 28811304
  8. The method developed to express and purify the entire extracellular region of CD62L resulted in a yield exceeding 20 mg/L of recombinant CD62L. An analysis of four similar CD62L constructs, primarily differing in signal sequences, revealed potential RNA pseudoknots in their signal sequences. PMID: 28842197
  9. CD62L was identified as a marker of a distinct NKT subset with high proliferative potential. Artificial antigen-presenting cells were developed to generate CD62L-enriched NKTs for effective cancer immunotherapy. PMID: 27183388
  10. The SELL polymorphisms -642C>T and 725C>T act as protective factors against acute coronary syndrome. SELL gene expression was elevated in ACS patients. PMID: 28478085
  11. Downregulation of CD62L due to unchecked HIV-1 replication may have significant implications for T-cell circulation, function, and HIV-1 disease progression. PMID: 27003497
  12. A higher frequency of LIN1(-) CCR3(+) eosinophils and reduced expression of CD23 and CD62L receptors in eosinophils were observed in AD patients. PMID: 27406841
  13. Indian patients with primary Sjogren's syndrome exhibit elevated salivary sL-selectin and IL-7 levels compared to healthy controls. PMID: 27620619
  14. While total surface expression of CD11b and L-selectin on neutrophils remained largely unaffected. PMID: 26361072
  15. CD62L expression on urothelial carcinoma cells suggests its potential as a biomarker to predict the presence or risk of developing metastatic disease in patients with bladder cancer. PMID: 25618296
  16. Freezing and thawing of murine and human Tregs leads to reduced expression of L-selectin (CD62L), a crucial factor contributing to the in vivo protective effects of Tregs. PMID: 26693907
  17. Glycopolymers from marine bacteria modify the adhesion molecule expression of human innate immune cells. PMID: 26852488
  18. HIV-1 downregulates CD62L in productively infected naive and memory resting CD4 T cells while suppressing Foxo1 activity and KLF2 mRNA expression. PMID: 25330112
  19. Polymorphisms within the L-selectin gene were not associated with Visceral leishmaniasis. These genotypes and alleles appear not to affect immune responses in Visceral leishmaniasis patients. PMID: 25209910
  20. Functional analyses have identified L-selectin (CD62L) as the key factor controlling the binding of chronic lymphocytic leukemia cells to high endothelial venule walls in vivo. PMID: 26162407
  21. SELL rs7531806 and rs1060573 are associated with androgen metabolism, inflammatory processes, and scar formation in severe acne. PMID: 24399259
  22. Both Nef and Vpu interact with and sequester CD62L in perinuclear compartments, hindering CD62L transport to the plasma membrane. PMID: 25822027
  23. Variants within the SELL gene are associated with sL-selectin levels. However, none of these variants were associated with clinical or subclinical cardiovascular disease. PMID: 25576479
  24. P-selectin glycoprotein ligand-1 and L-selectin play a role in neutrophil recruitment and activate human endothelial colony-forming cells at the site of vessel injury. PMID: 24606340
  25. Increased expression of L-selectin ligands may be involved in the implantation process in tubal pregnancy. PMID: 24829027
  26. A cellular model system for quantifying L-selectin adhesion mechanics has been developed. PMID: 23927766
  27. Individuals who regularly engage in physical activity experience reduced serum concentrations of proinflammatory molecules, including L-selectin and P-selectin, after each exercise session. PMID: 25095634
  28. In a large, multiethnic population, soluble L-selectin levels did not predict clinical or subclinical cardiovascular disease. PMID: 24631064
  29. The findings suggest a regulatory influence of MR signaling on human T-cell migration and a potential role for endogenous aldosterone in the redistribution of T-cell subsets to lymph nodes, involving CD62L, CCR7, and CXCR4. PMID: 24595810
  30. The association between the expression of the adhesion molecule CD62L (L-selectin) on naive and central memory T cells and the formation of antigen-specific antibodies differed significantly between younger and older donors. PMID: 23571167
  31. The signaling effects of the PSGL-1-L-selectin complex on neutrophil slow rolling and recruitment in vivo demonstrate the functional importance of this pathway. PMID: 24127491
  32. The moesin/l-selectin/CaM ternary complex, crucial for l-selectin function and shedding, is modulated by phospholipids. PMID: 23796515
  33. The association of calmodulin with L-selectin has been studied. PMID: 23658780
  34. Cell-based assessment of L-selectin-expressing CD4 T cells could provide a valuable biomarker for individual risk assessment of progressive multifocal leukoencephalopathy (PML). PMID: 23925765
  35. Blood samples from coronary artery disease patients showed a significantly higher L-selectin, but not CD11b response to TLR stimulation compared to controls. PMID: 23573259
  36. Overactivation of ADAM17 in NK cells may impair their effector functions by downregulating surface expression of CD16 and CD62L. PMID: 23487023
  37. ATP induces CD62L downregulation from the surface of naive CD4+ T lymphocytes through the P2X7 receptor. PMID: 23319734
  38. An association between L-selectin concentrations in plasma and skin damage in patients with systemic sclerosis has been observed. PMID: 23028631
  39. Native glycodelin-A binds to peripheral blood monocytes, inducing interleukin-6 secretion through L-selectin. PMID: 22977256
  40. Critical patch lengths of P- and L-selectin for initiating HL-60 cell binding in shear flow have been determined. PMID: 22627390
  41. A unique lymphoid-primed population in human bone marrow was generated from hematopoietic stem cells before the onset of CD10 expression and commitment to the B cell lineage. This population is characterized by high expression of the homing molecule L-selectin (CD62L). PMID: 22941246
  42. [review] Distinct domains of L-selectin contribute to proper leukocyte migration out of the vasculature into surrounding tissues during inflammation and immune surveillance. PMID: 21546114
  43. The P213S polymorphism of the L-selectin gene is associated with type 2 diabetes and insulin resistance. PMID: 22921892
  44. Pretreatment of cardiac mesoangioblasts with SDF-1 or transient expression of L-selectin induced a two- to three-fold increase in their transmigration and homing to the damaged heart. PMID: 21869829
  45. No statistically significant results were found to support the hypothesis of an association between the SELL gene P213S polymorphism, type 2 diabetes mellitus, and end-stage renal disease. PMID: 22119815
  46. Levels of P-selectin and L-selectin were decreased in AD and lowest in AD patients with the highest cognitive decline. These findings suggest that these molecules may induce alterations in endothelial regulation and influence neurodegenerative processes in AD. PMID: 21484243
  47. A lower frequency of CD62L(high) and a higher frequency of TNFR2(+) Tregs are associated with inflammatory conditions in type 1 diabetic patients. PMID: 21584225
  48. The L-selectin gene may play a role in the development of ischemic stroke. PMID: 21465128
  49. Data indicate that the L-selectin TM and cytoplasmic domains lack the ability to dimerize in cell membranes. PMID: 21316337

Show More

Hide All

Database Links

HGNC: 10720

OMIM: 153240

KEGG: hsa:6402

STRING: 9606.ENSP00000236147

UniGene: Hs.728756

Protein Families
Selectin/LECAM family
Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Expressed in B-cell lines and T-lymphocytes.

Q&A

What is Recombinant Human L-selectin (SELL)?

L-selectin, also known as Leukocyte adhesion molecule 1 (LAM-1) and CD62L, is a type-I transmembrane glycoprotein and cell adhesion molecule belonging to the Selectin family. It functions as a calcium-dependent (C-type) lectin that mediates initial adhesive steps during inflammation and immune surveillance. Recombinant Human L-selectin is a laboratory-produced version of this protein used for research purposes, often created as a chimera with an Fc region or other tags to facilitate purification and detection .

Structurally, mature L-selectin consists of an extracellular domain (ECD) with a C-type lectin domain and an epidermal growth factor (EGF)-like domain, a transmembrane domain, and a short cytoplasmic domain of 17 amino acids. Human L-selectin shares approximately 76-78% amino acid sequence identity with mouse and rat L-selectin within the extracellular domain .

What are the key structural domains of L-selectin and their functions?

L-selectin possesses a distinct domain organization that directly correlates with its adhesion and signaling functions:

![Domain Organization]
The domain architecture enables L-selectin to function both as an adhesion receptor and a signaling molecule during leukocyte trafficking and inflammatory responses .

How is L-selectin expressed in different immune cell populations?

L-selectin is constitutively expressed on a wide variety of leukocytes, serving critical roles in their migratory behavior:

  • Lymphocytes: Express the 74 kDa form of L-selectin. The protein plays a crucial role in lymphocyte migration into peripheral lymph nodes and sites of chronic inflammation .

  • Neutrophils: Express the larger 90-100 kDa form of L-selectin. In these cells, L-selectin facilitates migration into acute inflammatory sites .

  • Monocytes: L-selectin expression on monocytes regulates protrusion formation during transendothelial migration and establishes front-back cell polarity, which is essential for chemotaxis toward sites of damage .

The differential expression and glycosylation of L-selectin across these cell types suggests cell-specific functions, though this area requires further investigation .

What explains the molecular weight variation of L-selectin across different cell types?

Despite having a predicted molecular weight of approximately 30 kDa based on amino acid sequence alone, L-selectin exhibits significant variation in apparent molecular weight between different leukocyte populations:

  • Lymphocyte form: Approximately 74 kDa

  • Neutrophil form: 90-100 kDa

This variation is primarily attributed to cell type-specific post-translational modifications, particularly differential glycosylation patterns . The extensive glycosylation not only affects molecular weight but likely impacts functional properties such as ligand recognition, protein stability, and interaction with other molecules. While these differences have been documented, the precise functional implications of cell-specific glycosylation patterns remain an area requiring further research .

What splice variants of L-selectin have been identified and characterized?

Several splice variants of L-selectin have been identified and characterized in both mice and humans:

Mouse L-selectin variants:

  • The mouse sell gene comprises 9 exons.

  • Two splice variants have been identified: L-selectin-v1 and L-selectin-v2.

  • Both variants possess an additional exon positioned between exons 7 and 8.

  • These variants share the first 49bp sequence of this additional exon, while L-selectin-v2 extends for an extra 51bp immediately 3' to this region.

  • The splice variants have longer cytoplasmic tails compared to wild-type L-selectin:

    • Wild-type: 17 amino acids

    • L-selectin-v1: 30 amino acids

    • L-selectin-v2: 32 amino acids

Human L-selectin variants:

  • Human splice variants have also been identified, though the provided search results contain less detail about their specific structures .

  • Adhesion to sLeX under flow conditions

  • Ectodomain shedding in response to cellular activation

  • Signaling to p38 MAPK following antibody-mediated clustering

How is the human L-selectin gene regulated at the transcriptional level?

The human L-selectin gene (sell) is located on the long arm of chromosome 1 (1q24.2) and is arranged in tandem with other selectin family members (in the order: L-, P-, and E-selectin). The gene consists of ten exons spanning approximately 21.0 kb .

Transcriptional regulation:

  • FOXO1: This transcription factor has been identified as a key regulator of human sell gene transcription .

  • Additional transcription factors: Chromosome immunoprecipitation experiments in mice have identified several other transcription factors involved in regulating the mouse sell gene, including:

    • Mzf1

    • Klf2

    • Sp1

    • Ets1

    • Irf1

Understanding the regulatory mechanisms controlling L-selectin expression is crucial for research involving manipulation of L-selectin levels in experimental systems and potential therapeutic interventions targeting L-selectin-mediated processes.

How does L-selectin mediate leukocyte adhesion and migration?

L-selectin plays a critical role in the multi-step process of leukocyte extravasation:

  • Initial tethering and rolling: L-selectin acts in cooperation with P-selectin and E-selectin to mediate the initial interaction of circulating leukocytes with endothelial cells. This produces the characteristic "rolling" of leukocytes on the endothelium through interactions with sialyl Lewis X (sLeX) and other glycans on endothelial surfaces .

  • Firm adhesion: The initial selectin-mediated interaction is followed by stronger interactions involving ICAM-1 and VCAM-1 .

  • Transendothelial migration (TEM): Recent evidence suggests L-selectin plays a specific role in regulating monocyte protrusion during TEM. The ectodomain shedding of L-selectin during this process is essential for establishing front-back cell polarity, which enables emigrated cells to chemotax toward sites of damage .

This coordinated process ultimately leads to extravasation of leukocytes through the blood vessel wall into the extracellular matrix tissue, allowing them to reach sites of inflammation or infection .

What ligands does L-selectin interact with during leukocyte trafficking?

L-selectin interacts with diverse glycans and glycoproteins located in both luminal and abluminal regions of the vessel wall:

Primary ligands:

  • Sialyl Lewis X (sLeX): A tetrasaccharide carbohydrate that serves as a primary ligand for L-selectin during tethering and rolling phases of leukocyte adhesion .

  • Proteoglycans: Particularly important during transendothelial migration .

  • Glycosaminoglycans: Function as adhesive ligands in various contexts .

The N-terminal calcium-dependent (C-type) lectin domain of L-selectin is responsible for these interactions. The recognition of specific glycan structures by L-selectin is calcium-dependent and is crucial for the selectivity of leukocyte trafficking to specific tissues and inflammatory sites .

How does ectodomain shedding regulate L-selectin function?

Ectodomain shedding is a critical regulatory mechanism for L-selectin function:

  • Process: L-selectin contains a specific cleavage site in its extracellular domain that allows for proteolytic release of the extracellular portion (ectodomain) from the cell surface .

  • Timing and significance during TEM: Ectodomain shedding of L-selectin during monocyte transendothelial migration is essential for:

    • Establishment of front-back cell polarity

    • Enabling emigrated cells to chemotax toward sites of damage

    • Potentially regulating the strength and duration of adhesive interactions

  • Response to cellular activation: The splice variants of L-selectin show altered capacities in ectodomain shedding in response to cellular activation, suggesting that this process is tightly regulated and may be differentially controlled in various physiological contexts .

Understanding the mechanisms and consequences of L-selectin shedding provides important insights into leukocyte trafficking regulation and potential targets for therapeutic intervention in inflammatory diseases.

What are the optimal conditions for using Recombinant Human L-selectin in adhesion assays?

When utilizing Recombinant Human L-selectin in adhesion assays, researchers should consider the following methodological considerations:

Coating concentration and conditions:

  • Typical working concentration: 0.4-2 μg/mL for adhesion assays

  • ED50 (median effective dose): 0.35-3.5 μg/mL for supporting adhesion of LS180 human colorectal adenocarcinoma cells

Experimental protocol parameters:

  • Typical incubation conditions: 1 hour at 37°C

  • Cell density: Determined by specific experimental design (detailed protocols typically use 4 cells/well)

Reconstitution and storage:

  • Reconstitution: 0.1 mg/mL in sterile PBS

  • Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles

  • Formulation: Typically lyophilized from a 0.2 μm filtered solution in PBS

Important note: Optimal dilutions should be determined by each laboratory for each specific application, as performance may vary based on exact experimental conditions and cell types used .

What are the key considerations when designing experiments with Recombinant Human L-selectin Fc chimeras?

When designing experiments with Recombinant Human L-selectin Fc chimeras, researchers should account for several important factors:

Protein structure considerations:

  • Composition: Human L-Selectin (Trp39-Asn332, Accession # P14151) fused to Human IgG1 (Pro100-Lys330) with a 6-His tag

  • Molecular weight: Shows bands at 85-100 kDa under reducing conditions and 170-200 kDa under non-reducing conditions when resolved by SDS-PAGE

Carrier protein influence:

  • Carrier-free (CF) formulations are available for applications where the presence of BSA might interfere

  • BSA-containing formulations are generally recommended for cell/tissue culture applications and as ELISA standards due to enhanced stability and shelf-life

Experimental applications:

  • Bioassay applications: Several studies have demonstrated the utility of L-selectin Fc chimeras in bioassays examining leukocyte adhesion

  • Binding assays: Research has employed L-selectin constructs to evaluate interactions with potential ligands

Quality control metrics:

  • Functional validation: Activity should be confirmed through adhesion assays with appropriate cell types

  • Purity assessment: SDS-PAGE analysis under reducing and non-reducing conditions

How can researchers study the signaling pathways downstream of L-selectin engagement?

Investigating signaling pathways downstream of L-selectin engagement requires specialized experimental approaches:

Cytoplasmic tail interactions:

  • The 17-amino acid cytoplasmic tail of L-selectin interacts with several proteins including calmodulin, ERM proteins, and alpha-actinin

  • Researchers can use pull-down assays, co-immunoprecipitation, and protein-protein interaction studies to characterize these interactions

Experimental signaling analysis approaches:

  • Antibody-mediated clustering (AMC): This technique has been used to stimulate L-selectin signaling in vitro, particularly in studies of splice variants that showed altered signaling to p38 MAPK following AMC

  • Mutational analysis: Creating mutations in key residues of the cytoplasmic tail helps identify critical sites for interaction with signaling molecules

  • Splice variant overexpression: L-selectin splice variants with extended cytoplasmic tails demonstrate different signaling capacities and can be used as tools to understand signaling mechanisms

  • Phosphorylation studies: Analysis of phosphorylation events following L-selectin engagement can help map signaling cascades

Understanding L-selectin signaling is particularly important given its role in regulating monocyte protrusion during transendothelial migration and establishing cell polarity necessary for directed movement toward inflammatory sites .

How do glycosylation patterns affect L-selectin function in different cell types?

The functional impact of differential glycosylation patterns on L-selectin remains an underexplored area, despite clear evidence of cell type-specific variation:

Observed glycosylation differences:

  • Lymphocyte L-selectin: 74 kDa form

  • Neutrophil L-selectin: 90-100 kDa form

  • These differences arise from cell type-specific glycosylation processes

Potential functional implications:

  • Ligand recognition specificity: Different glycosylation patterns may alter the binding affinity or specificity for various ligands

  • Protein stability and half-life: Glycosylation can affect protein folding, stability, and resistance to proteolytic degradation

  • Interaction with other molecules: Modified glycan structures may influence how L-selectin interacts with other cell surface or soluble molecules

  • Cell-specific functions: The significant difference in molecular weight between lymphocyte and neutrophil forms suggests that glycosylation may confer cell type-specific functional properties

Methodological approaches to study glycosylation effects include:

  • Glycosidase treatments to remove specific glycan structures

  • Site-directed mutagenesis of glycosylation sites

  • Comparative studies of L-selectin from different cell types

  • Mass spectrometry analysis to characterize specific glycan structures

This area represents an important direction for future research, as understanding the functional consequences of differential glycosylation could provide insights into cell-specific behaviors and potential therapeutic targets .

What methodological approaches can be used to study the role of L-selectin in transendothelial migration?

Investigating L-selectin's role in transendothelial migration (TEM) requires specialized techniques:

In vitro experimental systems:

  • Transwell migration assays: Modified to incorporate L-selectin ligands or blocking antibodies

  • Flow chamber systems: Allow for real-time visualization of leukocyte adhesion and migration under physiological flow conditions

  • 3D endothelial cell models: Provide more physiologically relevant environments for studying TEM

Molecular and cellular techniques:

  • L-selectin shedding assays: Measure ectodomain shedding during TEM, which is critical for establishing front-back polarity

  • Live cell imaging: Track protrusion formation and polarization during TEM

  • CRISPR-Cas9 gene editing: Generate cells with specific mutations in L-selectin to study functional domains

  • Expression of L-selectin splice variants: Compare the TEM capacity of cells expressing different L-selectin variants

Analytical parameters:

  • Quantification of transmigration efficiency

  • Measurement of protrusion dynamics

  • Analysis of front-back polarity establishment

  • Tracking of post-migration chemotaxis toward inflammatory stimuli

This multifaceted approach helps elucidate the complex role of L-selectin beyond its well-established function in initial tethering and rolling, focusing on its emerging role in regulating monocyte protrusion and polarity during and after TEM .

How does soluble L-selectin in biological fluids impact experimental design and interpretation?

Soluble L-selectin presents important considerations for researchers:

Presence and variation:

  • Detectable levels of soluble L-selectin are present in biological fluids of apparently normal individuals

  • Levels may be elevated or lowered in subjects with various pathological conditions including Alzheimer's disease and rheumatoid arthritis

Experimental implications:

  • Interference with assays: Soluble L-selectin in biological samples may compete with cell-surface L-selectin for ligand binding, potentially affecting assay results

  • Background control considerations: Experiments using biological fluids should account for baseline levels of soluble L-selectin

  • Marker potential: Changes in soluble L-selectin levels may serve as biomarkers for certain disease states

Methodological approaches:

  • ELISA techniques: Can be used to quantify soluble L-selectin levels in biological fluids

  • Depletion strategies: May be necessary to remove soluble L-selectin from samples prior to certain experiments

  • Comparative analysis: Comparing soluble L-selectin levels across different patient populations or experimental conditions

Understanding the role and impact of soluble L-selectin is particularly important when designing experiments using human or animal biological fluids, as it may influence both experimental outcomes and interpretation of results in both basic research and clinical settings .

What is the significance of L-selectin in inflammatory and immune-related disorders?

L-selectin plays crucial roles in various inflammatory and immune-related disorders, with both diagnostic and therapeutic implications:

Rheumatoid arthritis:

  • Altered levels of L-selectin have been reported in rheumatoid arthritis patients

  • L-selectin contributes to leukocyte recruitment to inflamed synovial tissues

Alzheimer's disease:

  • Studies have reported changes in L-selectin levels in Alzheimer's disease patients

  • This may reflect altered immune cell trafficking in neurodegenerative conditions

Cancer:

  • L-selectin function is required for normal regulatory T cell (Treg) migration

  • Overexpression might result in reduced tumor growth, suggesting potential therapeutic applications

Acute inflammatory conditions:

  • L-selectin mediates neutrophil recruitment to acute inflammatory sites

  • Inhibition of L-selectin has been explored as a strategy to reduce harmful inflammatory responses

Research approaches in this area include:

  • Analysis of soluble L-selectin as a biomarker

  • Development of L-selectin antagonists as potential therapeutics

  • Use of animal models with L-selectin deficiency or overexpression

  • Examination of L-selectin-dependent leukocyte trafficking in tissue-specific inflammation models

Understanding L-selectin's role in these contexts provides insights into disease mechanisms and potential therapeutic targets for modulating inflammatory responses .

What experimental systems are available to study L-selectin-dependent leukocyte trafficking?

Several experimental systems have been developed to investigate L-selectin-dependent leukocyte trafficking:

In vitro systems:

  • Adhesion assays: Recombinant Human L-Selectin/CD62L Fc Chimera coated plates can be used to study adhesion in a dose-dependent manner

    • Typical conditions: 1-hour incubation at 37°C

    • ED50: 0.4-2 μg/mL for standard assays

    • ED50: 0.35-3.5 μg/mL for LS180 human colorectal adenocarcinoma cell adhesion

  • Flow chamber systems: Allow real-time visualization of leukocyte rolling and adhesion under physiological flow conditions

    • Can be modified with various L-selectin ligands to study binding specificity

  • Glycopeptide analogs: Synthetic glycoprotein mimics have been used to study L-selectin-mediated rolling and shedding mechanisms

Advanced techniques:

  • CRISPR-Cas9 genome editing: Used to quantify contributions of different glycan structures (O-glycans, N-glycans, and Glycosphingolipids) to human leukocyte-endothelium adhesion

  • Heterotropic modulation analysis: Studies using allosteric antibodies have revealed mechanisms by which selectin affinity can be modulated to affect leukocyte rolling

  • Intravital microscopy: Allows visualization of leukocyte trafficking in living animals

These experimental systems provide complementary approaches to understand the complex roles of L-selectin in leukocyte trafficking across different physiological and pathological contexts .

What are the emerging therapeutic applications targeting L-selectin?

Several therapeutic approaches targeting L-selectin have emerged from basic research:

Anti-inflammatory strategies:

  • Glycopeptide analogs of PSGL-1: These have been shown to inhibit P-selectin in vitro and in vivo, suggesting similar approaches might be effective for L-selectin inhibition

  • Synthetic glycoprotein mimics: These compounds can inhibit L-selectin-mediated rolling and promote L-selectin shedding, potentially reducing inflammatory cell recruitment

  • Allosteric antibodies: Research has demonstrated that heterotropic modulation of selectin affinity by allosteric antibodies affects leukocyte rolling, offering a potential therapeutic approach

Cancer immunotherapy applications:

  • L-selectin function is required for normal regulatory T cell (Treg) migration

  • Overexpression might result in reduced tumor growth, suggesting potential applications in cancer treatment

Considerations for therapeutic development:

  • Balancing immune suppression versus beneficial immune responses

  • Tissue-specific targeting to avoid systemic effects

  • Appropriate timing of intervention in acute versus chronic conditions

These emerging therapeutic applications represent promising directions for translating basic L-selectin research into clinical benefits for inflammatory diseases, autoimmune disorders, and potentially cancer .

How do recent findings about L-selectin splice variants impact our understanding of leukocyte function?

The discovery and characterization of L-selectin splice variants has expanded our understanding of leukocyte function in several ways:

Functional differences of splice variants:

  • Overexpression studies show that L-selectin splice variants (v1 and v2) exhibit altered capacities in:

    • Adhesion to sialyl Lewis X (sLeX) under flow conditions

    • Ectodomain shedding in response to cellular activation

    • Signaling to p38 MAPK following antibody-mediated clustering

Structural insights:

  • The mouse splice variants possess longer cytoplasmic tails compared to wild-type L-selectin:

    • Wild-type: 17 amino acids

    • L-selectin-v1: 30 amino acids

    • L-selectin-v2: 32 amino acids

  • These extended cytoplasmic domains likely provide additional protein interaction sites for signaling and cytoskeletal organization

Physiological implications:

  • Despite comprising only 2-3% of total L-selectin mRNA, these variants may play specialized roles in specific contexts

  • The extended cytoplasmic tails could provide enhanced or altered signaling capabilities in subsets of leukocytes or under particular activation conditions

Research directions:

  • Investigating the expression patterns of splice variants in different leukocyte subsets

  • Determining if expression levels change during activation or disease states

  • Identifying specific protein interactions unique to the extended cytoplasmic tails

These findings highlight the complexity of L-selectin-mediated functions and suggest that alternative splicing may represent an additional layer of regulation for leukocyte adhesion and signaling processes .

What methodological advances are improving our ability to study L-selectin function?

Recent methodological advances have significantly enhanced our ability to investigate L-selectin function:

Genetic engineering approaches:

  • CRISPR-Cas9 technology: This has been employed to quantify the contributions of different glycan structures (O-glycans, N-glycans, and Glycosphingolipids) to human leukocyte-endothelium adhesion mediated by L-selectin

  • Splice variant expression systems: Tools to express and study the functional consequences of L-selectin splice variants in various cell types

Structural and biochemical techniques:

  • Recombinant protein engineering: Production of various L-selectin constructs including:

    • Fc chimeras for improved detection and purification

    • Carrier-free formulations for applications where BSA might interfere

    • Constructs with specific mutations or truncations to study domain functions

  • Advanced imaging technologies: High-resolution microscopy techniques to visualize L-selectin distribution, clustering, and interactions during leukocyte adhesion and migration

Functional assays:

  • Synthetic glycoprotein mimics: These have been developed to study L-selectin-mediated rolling and shedding, providing tools to manipulate L-selectin function in controlled settings

  • Heterotropic modulation analysis: Methods using allosteric antibodies to study how selectin affinity changes affect leukocyte rolling

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.