Recombinant Human Lamina-associated polypeptide 2, isoforms beta/gamma (TMPO)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipments.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag is determined during production. If you require a particular tag, please inform us, and we will prioritize its inclusion.
Synonyms
TMPO; LAP2; Lamina-associated polypeptide 2, isoforms beta/gamma; Thymopoietin, isoforms beta/gamma; TP beta/gamma; Thymopoietin-related peptide isoforms beta/gamma; TPRP isoforms beta/gamma
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-454
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
TMPO
Target Protein Sequence
PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGTNSKG PPDFSSDEEREPTPVLGSGAAAAGRSRAAVGRKATKKTDKPRQEDKDDLDVTELTNEDLL DQLVKYGVNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDSD RYSDNEEDSKIELKLEKREPLKGRAKTPVTLKQRRVEHNQSYSQAGITETEWTSGSSKGG PLQALTRESTRGSRRTPRKRVETSEHFRIDGPVISESTPIAETIMASSNESLVVNRVTGN FKHASPILPITEFSDIPRRAPKKPLTRAEVGEKTEERRVERDILKEMFPYEASTPTGISA SCRRPIKGAAGRPLELSDFRMEESFSSKYVPKYVPLADVKSEKTKKGRSIPVWIKILLFV VVAVFLFLVYQAMETNQVNPFSNFLHVDPRKSN
Uniprot No.

Target Background

Function
Lamina-associated polypeptide 2 (TMPO) isoforms beta/gamma may contribute to nuclear lamina assembly, maintaining nuclear envelope structure. It potentially acts as a receptor for lamin filament attachment to the inner nuclear membrane and may regulate DNA replication initiation through interaction with NAKAP95. Furthermore, related peptides, thymopoietin (TP) and thymopentin (TP5), may play a role in T-cell development and function, with TP5 exhibiting immunomodulatory properties.
Database Links

HGNC: 11875

OMIM: 188380

KEGG: hsa:7112

UniGene: Hs.11355

Protein Families
LEM family
Subcellular Location
Nucleus inner membrane; Single-pass type II membrane protein. Note=Tightly associated with the nuclear lamina.; [Isoform Zeta]: Cytoplasm.
Tissue Specificity
Expressed in many tissues. Most abundant in adult thymus and fetal liver.

Q&A

What is the structural composition of Recombinant Human Lamina-associated polypeptide 2 isoforms beta/gamma?

Recombinant Human Lamina-associated polypeptide 2 isoforms beta and gamma share common structural elements while maintaining distinct characteristics. Based on comparative studies with zebrafish orthologs, these proteins contain an N-terminal region with a LEM domain, and in their C-terminal portions, a lamina binding domain and a membrane spanning sequence . The LEM domain facilitates interactions with chromatin through binding to barrier-to-autointegration factor (BAF), enabling these proteins to connect the nuclear envelope with chromatin. The lamina binding domain mediates interactions with nuclear lamins, anchoring these proteins within the nuclear envelope architecture. These structural features are critical for the proteins' roles in nuclear envelope dynamics and chromosome organization during cell division. The differences between beta and gamma isoforms primarily reside in their C-terminal regions, which contribute to their distinct functional properties.

How do the functional properties of TMPO beta and gamma isoforms differ?

The functional properties of TMPO beta and gamma isoforms demonstrate significant differences, particularly regarding their interactions with chromosomes during mitosis. Research using zebrafish models has shown that the beta isoform associates with mitotic chromosomes before anaphase, while the gamma isoform does not display this property . When expressed as GFP fusion proteins in Xenopus A6 cells, the beta isoform localizes to mitotic chromosomes and these chromosomes become decorated with vesicles, suggesting a role in nuclear envelope reformation during mitosis . The gamma isoform, despite sharing common N-terminal domains with the beta isoform, does not associate with mitotic chromosomes under similar experimental conditions. These functional differences indicate distinct roles in cell division processes, with the beta isoform potentially facilitating attachment of membrane vesicles to chromosomes during nuclear envelope reassembly, while gamma isoform may serve primarily structural functions during interphase.

What expression patterns characterize TMPO isoforms in different cell types?

Expression patterns of TMPO isoforms vary significantly across different cell types and developmental stages. Studies in zebrafish have provided valuable insights, showing that the omega isoform (analogous to certain human isoforms) predominates during early embryonic development, particularly in rapidly dividing cells up to the gastrula stage . As development progresses, expression shifts toward the beta and gamma isoforms, with the gamma isoform becoming predominant in differentiated somatic cells while beta is expressed at lower levels . This developmental regulation suggests specialized functions for different isoforms depending on cellular context. In human cells, similar isoform-specific expression patterns likely occur, with potential variations in proliferating versus differentiated cells, and possibly tissue-specific differences. These expression patterns should be considered when designing experiments, as the relative abundance of each isoform may influence nuclear envelope properties and cellular functions.

What are the recommended experimental models for studying TMPO isoforms?

When selecting experimental models for studying TMPO isoforms, researchers should consider systems that allow for both cellular and molecular analyses of these nuclear envelope proteins. Cell culture models, particularly those amenable to transfection with fluorescently-tagged constructs like Xenopus A6 cells, provide valuable systems for studying subcellular localization and dynamics . Human cell lines such as HeLa or U2OS offer relevant contexts for examining human TMPO function, particularly when combined with gene editing approaches. For developmental contexts, zebrafish has proven useful for studying LAP2 isoform expression patterns and functions during embryogenesis . When working with recombinant proteins, bacterial expression systems can provide sufficient material for biochemical and structural studies, though eukaryotic expression systems may better preserve post-translational modifications. Each model system presents distinct advantages: cell lines allow for high-resolution imaging and biochemical analyses, while animal models provide insights into developmental regulation and tissue-specific functions.

What methodologies can distinguish between chromosome binding properties of TMPO beta versus gamma isoforms?

To distinguish between the chromosome binding properties of TMPO beta versus gamma isoforms, researchers should employ a multi-faceted methodological approach. Live cell imaging using fluorescently-tagged constructs provides direct visualization of isoform-specific localization during mitosis, as demonstrated in studies showing beta isoform association with mitotic chromosomes while gamma lacks this property . Chromatin immunoprecipitation (ChIP) with isoform-specific antibodies can identify DNA sequences preferentially bound by each isoform. For higher resolution analysis, combining super-resolution microscopy with proximity ligation assays enables visualization of specific associations between TMPO isoforms and chromosomal proteins. Domain swapping experiments, creating chimeric proteins containing regions from different isoforms, can identify specific sequences responsible for chromosome binding, similar to approaches that revealed the importance of N-terminal regions in conjunction with beta-specific sequences for chromosome association . Cell cycle synchronization is essential for these experiments, as chromosome binding occurs at specific mitotic phases. Comparing binding patterns across multiple cell types provides insights into the conservation and context-dependency of these isoform-specific properties.

How do post-translational modifications regulate TMPO isoform functions?

Post-translational modifications (PTMs) likely serve as critical regulators of TMPO isoform functions, though detailed characterization requires further investigation. Phosphorylation represents a primary regulatory mechanism, particularly during mitosis when nuclear envelope dynamics are tightly controlled. Cell cycle-dependent kinases potentially modify specific residues in TMPO isoforms, regulating their interactions with chromosomes and other nuclear envelope components. The timing of beta isoform association with mitotic chromosomes suggests regulation by mitotic kinases . Beyond phosphorylation, other modifications such as acetylation, methylation, or SUMOylation may influence TMPO functions. To systematically characterize these modifications, researchers should employ mass spectrometry to identify modification sites, create modification-specific antibodies to track temporal patterns, and develop phosphomimetic or phospho-dead mutants to assess functional consequences. Domain-specific modifications may explain isoform-specific behaviors, particularly the distinct chromosome binding properties of beta versus gamma isoforms . Correlation of modification patterns with cell cycle progression and nuclear envelope remodeling would provide valuable insights into the regulatory mechanisms controlling TMPO functions.

What molecular mechanisms underlie TMPO involvement in nuclear envelope reassembly?

The molecular mechanisms underlying TMPO involvement in nuclear envelope reassembly involve coordinated interactions with chromosomes, membrane components, and nuclear structural proteins. Studies in zebrafish have shown that during early embryonic development, ZLAP2omega becomes associated with mitotic chromosomes before anaphase, and these chromosomes become decorated with vesicles . This chromosome association appears mediated by the N-terminal region in conjunction with isoform-specific sequences, as demonstrated through analysis of ZLAP2-GFP fusion proteins . The beta isoform similarly associates with mitotic chromosomes when expressed in Xenopus cells, suggesting conservation of this function . These observations indicate a potential role in recruiting membrane vesicles to chromatin surfaces during nuclear envelope reformation. The sequential binding of TMPO to chromosomes, followed by vesicle recruitment, suggests a templating function that guides membrane components to appropriate chromatin regions. Differential expression of isoforms during development, with transitions from omega to beta/gamma predominance, further suggests specialized roles in nuclear envelope dynamics adapted to specific cellular contexts .

How does TMPO interact with other nuclear envelope proteins in a multiprotein complex?

TMPO isoforms function within complex protein networks at the nuclear envelope, engaging in multiple protein-protein interactions that influence nuclear architecture and function. These interactions likely include associations with nuclear lamins through the lamina binding domain, connections to chromatin via the LEM domain's interaction with BAF, and potential binding to other inner nuclear membrane proteins. The isoform-specific regions may mediate distinct interaction profiles, explaining functional differences between beta and gamma variants. During mitosis, beta isoform interactions with chromosome surfaces and membrane vesicles suggest specific binding partners involved in nuclear envelope reassembly . To characterize these interaction networks, proximity labeling approaches (BioID, APEX) coupled with mass spectrometry can identify proteins in close proximity to specific TMPO isoforms. Co-immunoprecipitation studies with isoform-specific antibodies followed by proteomic analysis can reveal direct binding partners. Differences in interactome composition between isoforms would provide insights into their specialized functions. Additionally, investigating how these interaction networks change during the cell cycle, particularly during nuclear envelope breakdown and reassembly, would illuminate the dynamic regulation of TMPO-containing complexes.

What control conditions are essential when studying TMPO isoform localization?

When studying TMPO isoform localization, several critical control conditions must be implemented to ensure reliable results. First, expression level controls are essential, as overexpression can lead to artifacts; comparing expression levels to endogenous protein and using inducible systems can mitigate this issue. Second, tag position controls should be employed, testing both N-terminal and C-terminal tags to ensure fusion proteins reflect native behavior, as demonstrated in studies with ZLAP2-GFP constructs . Third, cell cycle synchronization is crucial when studying proteins with dynamic, cell cycle-dependent localization patterns like the chromosome association of beta isoforms during mitosis . Fourth, co-localization with established nuclear envelope markers (lamins, nuclear pore components) provides positive controls for expected distributions. Fifth, domain mutant controls, particularly mutations in known functional regions like the LEM domain or lamina binding region, help establish specificity of observed localization patterns. Finally, isoform-switching experiments, where one isoform is replaced with another, can highlight isoform-specific localization properties. Including these comprehensive controls enables researchers to distinguish genuine biological phenomena from technical artifacts and accurately characterize TMPO isoform distributions.

How should researchers design experiments to assess TMPO isoform-specific functions?

Designing experiments to assess TMPO isoform-specific functions requires a systematic approach that isolates the contributions of individual isoforms while considering their potential interdependencies. Begin with a clear hypothesis based on known structural and localization differences between isoforms, such as the distinct chromosome binding properties of beta versus gamma variants . Implement isoform-specific knockdown or knockout strategies using siRNA or CRISPR-Cas9 targeting unique exons, followed by rescue experiments with individual isoforms to establish their non-redundant functions. Domain swapping approaches, creating chimeric proteins with regions from different isoforms, can identify functional domains responsible for specific activities, similar to studies that identified chromosome-binding regions in zebrafish LAP2 isoforms . Cell cycle analysis is essential when examining functions related to nuclear dynamics, with synchronization methods enabling precise temporal assessment. Control groups must include appropriate negative controls (non-targeting siRNAs, expression of unrelated nuclear proteins) to distinguish specific effects from general perturbations . Sufficient sample sizes determined through power analysis are crucial to detect potentially subtle phenotypic differences between isoforms . Finally, multi-parameter analysis examining effects on nuclear morphology, chromatin organization, and cell cycle progression provides comprehensive functional assessment.

What are the optimal conditions for expressing and purifying recombinant TMPO isoforms?

The optimal conditions for expressing and purifying recombinant TMPO isoforms must address the challenges associated with membrane-associated nuclear proteins. For expression systems, mammalian cells (HEK293, CHO) often provide superior folding and post-translational modifications for human proteins, though insect cells (Sf9, Hi5) offer scalability advantages. Expression temperature optimization is critical, with lower temperatures (16-25°C) typically improving solubility of membrane-associated proteins. For constructs, consider truncation strategies that remove the transmembrane domain while retaining functional regions of interest, similar to approaches used for studying domains of zebrafish LAP2 isoforms . Affinity tags should be positioned to avoid interference with functional domains, particularly the LEM domain and isoform-specific regions that mediate chromosome binding. During purification, detergent selection requires careful optimization, with mild non-ionic detergents (DDM, CHAPS) often suitable for maintaining stability while effectively solubilizing membrane-associated regions. Size exclusion chromatography as a final purification step helps ensure homogeneity. For functional studies, verify protein activity through binding assays with known interaction partners (BAF, lamins) or chromatin binding assays for beta isoforms. Storage conditions should be optimized to prevent aggregation, typically requiring glycerol and reducing agents.

How should researchers interpret changes in TMPO isoform expression during cellular differentiation?

Interpreting changes in TMPO isoform expression during cellular differentiation requires contextual analysis that considers the functional implications of shifting isoform ratios. Establish baseline expression profiles in undifferentiated cells as reference points, then track temporal changes through differentiation processes using isoform-specific quantification methods. Consider both relative ratios and absolute levels, as they provide complementary information about isoform regulation. In zebrafish, developmental progression shows a transition from omega isoform predominance in embryonic cells to increased beta and gamma isoforms in somatic cells, with gamma becoming the predominant form . Similar transitions likely occur during human cellular differentiation, potentially reflecting changing nuclear envelope requirements. Correlate expression changes with nuclear morphological alterations that accompany differentiation, as different isoforms may support specific nuclear architectures. Functional significance can be assessed through targeted perturbation of specific isoforms at critical differentiation stages. When interpreting data, consider that even subtle changes in isoform ratios may have significant functional consequences if isoforms possess distinct, non-redundant properties, as demonstrated by the different chromosome binding capabilities of beta versus gamma isoforms . Finally, examine whether expression changes coincide with key differentiation events or cell cycle alterations to identify potential regulatory relationships.

How can researchers effectively control for confounding variables in TMPO functional studies?

Controlling for confounding variables in TMPO functional studies requires systematic identification and mitigation of factors that could influence experimental outcomes. Cell cycle synchronization is particularly critical given the cell cycle-dependent localization patterns of TMPO isoforms, especially the mitotic chromosome association observed with beta isoforms . Standardize culture conditions, including serum lots, cell density, and passage number, which can affect nuclear envelope properties and protein expression. Control for potential effects of expression tags by comparing multiple tag positions and types, as fusion proteins may behave differently depending on tag placement . When manipulating TMPO expression through knockdown or overexpression, monitor effects on related nuclear envelope proteins that might compensate for or amplify TMPO-related phenotypes. In genetic manipulation experiments, use rescue controls with siRNA-resistant constructs or complementary approaches (siRNA and CRISPR) to confirm specificity. For treatments affecting nuclear structure, include appropriate vehicle controls and dose-response analyses. When comparing isoform functions, control for expression levels to ensure phenotypic differences reflect functional properties rather than concentration effects. By systematically addressing these potential confounding variables, researchers can increase confidence that observed effects are specifically attributable to TMPO function rather than experimental artifacts .

What approaches help resolve contradictory findings in TMPO literature?

Resolving contradictory findings in TMPO literature requires systematic analysis of methodological differences and biological context variations. First, create a comprehensive comparison table documenting contradictory studies, highlighting differences in experimental systems, isoforms examined, methodologies, and conditions. Second, perform direct replication studies under standardized conditions, systematically varying potential contributing factors to identify sources of discrepancy. Third, consider cell type specificity, as TMPO functions may vary between cell types similar to the differential expression patterns observed across developmental stages in zebrafish . Fourth, examine whether contradictions relate to specific cell cycle phases, particularly given the dynamic behavior of TMPO isoforms during mitosis . Fifth, assess technical variables including antibody specificity, protein tagging approaches, and expression levels, which can significantly impact experimental outcomes. Sixth, employ orthogonal methodologies to validate key findings, as technical biases inherent to specific approaches may contribute to apparent contradictions. Finally, develop integrative models that accommodate seemingly contradictory findings by proposing context-dependent mechanisms, similar to how understanding the developmental regulation of LAP2 isoforms helps explain their distinct functional profiles . This systematic approach transforms contradictions into opportunities for deeper mechanistic understanding of TMPO biology.

How can CRISPR-Cas9 approaches be optimized for studying TMPO isoform functions?

Optimizing CRISPR-Cas9 approaches for studying TMPO isoform functions requires strategic targeting and control strategies that distinguish between isoform-specific and shared functions. Design guide RNAs targeting common exons to eliminate all TMPO isoforms simultaneously, while targeting unique exons or splice junctions allows selective disruption of beta or gamma variants. When designing rescue experiments, introduce silent mutations in guide-binding regions to create CRISPR-resistant constructs for complementation studies. Consider inducible CRISPR systems to control the timing of TMPO disruption, allowing examination of acute versus chronic loss effects and avoiding potential compensatory mechanisms. For subtle functional manipulations, employ CRISPR base or prime editing to introduce specific point mutations that alter functional domains without eliminating the protein, such as modifying residues in regions that mediate the chromosome binding observed in beta isoforms . To track endogenous proteins, implement CRISPR knock-in strategies to tag specific isoforms with fluorescent proteins or epitope tags at their genomic loci, maintaining native expression control. Validate all CRISPR modifications through sequencing, expression analysis, and functional assays to confirm the precise molecular alterations achieved. Finally, consider cell type selection carefully, as the functions of TMPO isoforms may vary across cellular contexts, similar to their differential expression patterns observed across developmental stages .

What cutting-edge imaging techniques provide the most valuable insights into TMPO dynamics?

Cutting-edge imaging techniques offer powerful approaches for investigating TMPO dynamics at high spatial and temporal resolution. Super-resolution microscopy (STED, PALM, STORM) overcomes the diffraction limit to visualize TMPO organization within the nuclear envelope at nanometer resolution, potentially resolving isoform-specific distributions. Live-cell imaging with lattice light-sheet microscopy enables visualization of TMPO dynamics during mitosis with minimal phototoxicity, critical for capturing transient events like chromosome association of beta isoforms before anaphase . Fluorescence recovery after photobleaching (FRAP) and photoactivation studies reveal mobility and exchange rates of different TMPO isoforms within the nuclear envelope, providing insights into their dynamic behaviors. Single-molecule tracking approaches can monitor the movement of individual TMPO molecules, potentially distinguishing different mobility populations. Förster resonance energy transfer (FRET) sensors designed to detect TMPO conformational changes or interactions with binding partners enable visualization of molecular events in living cells. Correlative light and electron microscopy (CLEM) provides ultrastructural context for fluorescence observations, particularly valuable for examining TMPO's role in nuclear envelope reassembly and the decoration of chromosomes with membrane vesicles observed during early development . These advanced imaging approaches, particularly when combined, provide multiscale views of TMPO dynamics from molecular interactions to cellular organization.

How can proteomics approaches advance understanding of TMPO isoform interactions?

Proteomics approaches offer powerful tools for comprehensively characterizing TMPO isoform interactions and post-translational modifications. Proximity labeling methods (BioID, APEX) coupled with mass spectrometry enable identification of proteins in close proximity to specific TMPO isoforms within the nuclear envelope microenvironment, revealing isoform-specific interaction networks. Crosslinking mass spectrometry (XL-MS) can capture direct protein-protein interactions and identify specific binding interfaces between TMPO and partners like chromatin components or other nuclear envelope proteins. Quantitative approaches such as SILAC or TMT labeling allow comparative analysis of interaction profiles across different conditions, such as various cell cycle stages or developmental time points, potentially explaining the differential behaviors of isoforms during mitosis . Phosphoproteomics analysis can identify cell cycle-dependent modifications that might regulate the association of beta isoforms with mitotic chromosomes, providing insights into the molecular mechanisms controlling their localization. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can reveal structural dynamics and conformational changes in TMPO upon binding to partners or chromatin. When designing these experiments, researchers should include appropriate controls and consider subcellular fractionation to enrich for nuclear envelope components. Integration of proteomics data with functional studies creates a comprehensive understanding of how protein interactions and modifications regulate TMPO isoform-specific functions.

What emerging technologies show promise for manipulating TMPO function with temporal precision?

Emerging technologies offering temporal precision in manipulating TMPO function provide new opportunities for dissecting the dynamic roles of these nuclear envelope proteins. Optogenetic approaches utilizing light-sensitive protein domains (CRY2/CIB1, LOV domains) enable rapid, reversible recruitment of TMPO to specific subcellular locations or induction of protein-protein interactions upon light stimulation. These systems could be particularly valuable for manipulating TMPO interactions with chromosomes or other nuclear envelope components during specific cell cycle phases. Chemical-genetic approaches, such as auxin-inducible degron tags, allow rapid protein degradation upon small molecule addition, enabling acute depletion of specific TMPO isoforms to assess immediate consequences versus adaptive responses. Small molecule-induced proximity systems (FKBP/FRB with rapamycin derivatives) enable controlled dimerization of TMPO with interaction partners or effector proteins. Phase separation modulators targeting intrinsically disordered regions in TMPO could regulate potential biomolecular condensate formation at nuclear envelope interfaces. CRISPR activation/interference (CRISPRa/CRISPRi) with inducible systems allows temporal control of endogenous TMPO isoform expression. These technologies enable precise manipulation of TMPO functions during specific cellular processes, such as mitotic chromosome association , providing insights into the temporal requirements and acute roles of different isoforms that complement traditional genetic approaches with constitutive manipulation.

What are the most significant open questions in TMPO isoform research?

Despite advances in understanding TMPO isoform biology, several significant questions remain unresolved. First, the precise mechanisms underlying isoform-specific chromosome binding properties, particularly the molecular basis for beta isoform association with mitotic chromosomes while gamma lacks this property , require further characterization. Second, the functional consequences of developmental or cell type-specific isoform expression patterns, similar to the transitions observed in zebrafish from omega to beta/gamma predominance , remain to be fully elucidated in human contexts. Third, the regulatory mechanisms controlling isoform expression ratios and potential isoform switching during cellular processes like differentiation or stress responses need investigation. Fourth, the specific contributions of TMPO isoforms to nuclear envelope reassembly during mitosis, particularly the coordination between chromosome binding and membrane recruitment , require detailed mechanistic clarification. Fifth, the roles of post-translational modifications in regulating isoform-specific functions remain largely unexplored. Sixth, the potential involvement of TMPO dysregulation in disease processes affecting nuclear structure and function represents an important translational direction. Addressing these questions will require integration of advanced technologies including super-resolution imaging, proximity proteomics, and precise genetic manipulation strategies with temporal control. These investigations will enhance our fundamental understanding of nuclear envelope biology while potentially revealing therapeutic targets for diseases involving nuclear dysfunction.

How might TMPO research contribute to understanding broader nuclear envelope biology?

TMPO research serves as a valuable model for understanding broader principles in nuclear envelope biology through several key contributions. First, the isoform-specific properties of TMPO, particularly the distinct chromosome binding behaviors of beta versus gamma variants , provide insights into how protein diversity through alternative splicing creates functional specialization at the nuclear envelope. Second, developmental regulation of TMPO isoforms, with transitions from embryonic to somatic predominant forms , illuminates mechanisms of nuclear envelope remodeling during differentiation and development. Third, TMPO's role in nuclear envelope reassembly during mitosis, particularly through chromosome binding and vesicle recruitment , offers a window into the precise orchestration of post-mitotic nuclear reformation. Fourth, the integration of TMPO into multiprotein complexes at the nuclear envelope exemplifies principles of macromolecular assembly that maintain nuclear structure and function. Fifth, the membrane-chromosome interfaces mediated by proteins like TMPO beta represent critical connections between nuclear architecture and genome organization. By advancing our understanding of these fundamental processes through TMPO research, investigators contribute to a comprehensive model of nuclear envelope biology that extends beyond any single protein family, potentially informing therapeutic approaches for the diverse spectrum of diseases involving nuclear dysfunction, from cancer to premature aging syndromes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.