Recombinant Human LEM domain-containing protein 1 (LEMD1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
LEMD1; LEM domain-containing protein 1; Cancer/testis antigen 50; CT50; LEM domain protein 1; LEMP-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-181
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
LEMD1
Target Protein Sequence
MVDVKCLSDCKLQNQLEKLGFSPGPILPSTRKLYEKKLVQLLVSPPCAPPVMNGPRELDG AQDSDDSEELNIILQGNIILSTEKSKKLKKWPEASTTKRKAVDTYCLDYKPSKGRRWAAR APSTRITYGTITKERDYCAEDQTIESWREEGFPVGLKLAVLGIFIIVVFVYLTVENKSLF G
Uniprot No.

Target Background

Gene References Into Functions
  1. LEMD1 exhibits five transcript variants (V1-V5). LEMD1 V1, V2, and V3 are expressed in testis and CR-CSCs/CICs, while V4 and V5 show ubiquitous expression. (PMID: 28219643)
  2. Downregulation of LEMD1 inhibits OSCC adhesion and transmigration. (PMID: 27280633)
  3. In prostate cancer samples, ODF1, ODF2, LEMD1, and SPATA19 expression was observed in 10%, 10%, 23%, and 40% of samples, respectively. No expression was detected in BPH samples. (PMID: 20682177)
  4. LEMD1 is a novel testis-specific gene expressed in colorectal cancers. (PMID: 15254688)
Database Links

HGNC: 18725

OMIM: 610480

KEGG: hsa:93273

STRING: 9606.ENSP00000356121

UniGene: Hs.655520

Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Testis-specific. Isoform 6 is detected in 17 of 18 colon cancer tissues examined.

Q&A

What is LEMD1 and what are its structural characteristics?

LEMD1 (LEM domain-containing protein 1) is also identified as Cancer/testis antigen 50 (CT50), LEM domain protein 1, or LEMP-1 . It belongs to the cancer-testis antigen (CTA) family and was first isolated from colorectal cancer in 2004 . The protein has a predicted band size of 20 kDa and contains a characteristic LEM domain that is essential for its function . This domain is typically involved in nuclear organization and gene expression regulation through interactions with chromatin and nuclear lamina components. The recombinant form of LEMD1 used in research usually corresponds to the full protein sequence from amino acid 1 to the C-terminus .

What experimental methods are most reliable for detecting LEMD1 expression?

Western blotting (WB) is the most validated method for detecting LEMD1 protein expression in human samples . For optimal results, antibody dilutions of 1/1000 have been successfully used in human fetal testis lysate samples . For gene expression analysis, RT-qPCR has been effectively employed to quantify LEMD1 mRNA levels in tumor cells . Researchers have also utilized publicly available genomic datasets (including GSE65216, GSE20713, GSE45827, and GSE76275) from the Gene Expression Omnibus (GEO) to analyze LEMD1 expression patterns across different cancer types . Immunohistochemistry can also be used for detecting LEMD1 in tissue sections, though specific protocols must be optimized based on the antibody used.

What is the normal expression pattern of LEMD1 in human tissues?

LEMD1 exhibits a highly restricted expression pattern in normal tissues. In healthy adults, LEMD1 expression is primarily limited to testicular tissue, which is characteristic of its classification as a cancer-testis antigen . This restricted expression pattern makes it an interesting candidate for cancer research, as it is aberrantly expressed in various malignancies but minimally expressed in normal adult tissues. Analysis across multiple cell lines using the Cancer Cell Line Encyclopedia (CCLE) database has demonstrated that LEMD1 is highly expressed in colorectal cancer cells compared to other tumor cell types, with SW480 cells showing particularly high expression levels .

What signaling pathways does LEMD1 interact with?

LEMD1 has been found to interact with several critical signaling pathways:

  • ERK signaling pathway: LEMD1 promotes triple-negative breast cancer (TNBC) progression by activating the ERK signaling pathway .

  • PI3K/Akt signaling pathway: In colon cancer, LEMD1 activates the PI3K/Akt pathway, which is critical for cancer cell proliferation, survival, and metastasis . LEMD1 deletion reduces the expression of phosphorylated PI3K and AKT proteins .

  • RhoA/ROCK signaling pathway: LEMD1 promotes colorectal cancer cell migration through activation of the RhoA/ROCK pathway, which is involved in cytoskeletal reorganization and cell motility .

These interactions highlight LEMD1's role as a multifunctional protein that can influence various aspects of cancer cell biology through different molecular mechanisms.

How does LEMD1 contribute to cancer progression and metastasis?

LEMD1 functions as an oncogene across multiple cancer types, contributing to cancer progression through several mechanisms:

  • Cell Proliferation: LEMD1 enhances cancer cell proliferation, as demonstrated in gastric cancer and TNBC models. Silencing of LEMD1 significantly inhibits the proliferation of TNBC cells in vitro .

  • Migration and Invasion: LEMD1 facilitates cancer cell invasion and migration. In colorectal cancer, LEMD1 regulates these processes through the RhoA/ROCK signaling pathway . Similarly, in oral squamous cell carcinoma, thyroid cancer, and pancreatic cancer, LEMD1 promotes invasion .

  • Epithelial-Mesenchymal Transition (EMT): LEMD1 promotes EMT in several cancer types, including oral squamous cell carcinoma, thyroid cancer, and pancreatic cancer . This process is crucial for metastasis as it allows epithelial cells to acquire a more invasive phenotype.

  • Angiogenesis: In colon cancer models, LEMD1 contributes to angiogenesis, facilitating tumor growth and potentially metastasis .

  • Tumor Formation: In vivo studies have shown that LEMD1 knockdown abolishes tumor formation of TNBC cells, highlighting its critical role in tumorigenesis .

The clinical significance of these contributions is reflected in the correlation between high LEMD1 expression and poor prognosis in cancer patients, including TNBC and colorectal cancer patients .

What experimental approaches are most effective for studying LEMD1 knockdown effects?

For effective LEMD1 functional studies, researchers have successfully employed several experimental approaches:

  • In vitro approaches:

    • RNA interference: siRNA or shRNA targeting LEMD1 has been effectively used to achieve knockdown in various cancer cell lines .

    • Cell viability assays: CCK-8 assays have been utilized to measure the effects of LEMD1 knockdown on cell proliferation .

    • Colony formation assays: These assess the long-term effects of LEMD1 silencing on cancer cell growth and survival .

    • Migration/invasion assays: Transwell and wound healing assays have been employed to evaluate the impact of LEMD1 knockdown on cell motility .

    • Angiogenesis assays: Tube formation assays have been used to assess the effects of LEMD1 on angiogenesis .

  • In vivo approaches:

    • Xenograft models: MDA-MB-231 cells with stable LEMD1 knockdown have been injected subcutaneously into BALB/c nude mice (1 × 10^6 cells in 100 μL medium) to study tumor growth .

    • Tumor measurement: Tumor sizes are typically measured every other day, with volume calculated as length × width^2 × (π/6) .

For optimal experimental design, it is recommended to include appropriate controls and validate knockdown efficiency at both mRNA and protein levels before assessing functional outcomes.

What is the relationship between LEMD1 expression and clinical outcomes in cancer patients?

LEMD1 expression has significant associations with clinical outcomes across multiple cancer types:

CharacteristicLEMD1 Expressionp Value
Histology Grade
Low12 (Low) / 24 (High)0.030
High2 (Low) / 21 (High)
Tumor size, cm
<35 (Low) / 27 (High)0.121
≥310 (Low) / 21 (High)
Lymph node metastasis
No7 (Low) / 26 (High)0.612
Yes8 (Low) / 22 (High)
TNM stage
I/II7 (Low) / 26 (High)0.612
III/IV8 (Low) / 22 (High)

Key findings from clinical studies include:

  • Prognostic value: High LEMD1 expression correlates with poor prognosis in multiple cancer types, including TNBC, colorectal cancer, gastric cancer, and pancreatic cancer .

  • Disease-free survival: Patients with low expression of LEMD1 have shorter disease-free survival and lower risk of postoperative recurrence in colorectal cancer .

  • Histological grade: In TNBC, LEMD1 expression is significantly associated with histological grade (p=0.030), with higher expression in high-grade tumors .

  • Metastatic potential: LEMD1 expression varies according to different N stage and M stage in colorectal cancer .

These findings highlight LEMD1's potential as both a prognostic biomarker and a therapeutic target in cancer management.

How does LEMD1 affect chemosensitivity in cancer cells?

LEMD1 expression has been linked to chemotherapy response, particularly in TNBC. Knockdown of LEMD1 renders TNBC cells more sensitive to paclitaxel, a commonly used chemotherapeutic agent . This suggests that LEMD1 may contribute to chemoresistance mechanisms in cancer cells.

The mechanism behind this enhanced chemosensitivity may involve:

  • Alterations in survival signaling pathways: LEMD1 activates the ERK and PI3K/Akt signaling pathways, which are known to promote cell survival and resist apoptosis induced by chemotherapeutic agents .

  • Changes in cell cycle regulation: LEMD1 may affect cell cycle checkpoints that determine cellular response to DNA-damaging agents.

  • Modulation of drug efflux mechanisms: Although not directly demonstrated, LEMD1 might influence the expression or function of drug transporters.

To study LEMD1's role in chemosensitivity, researchers can employ several experimental approaches:

  • Combination treatment studies: Testing cancer cells with LEMD1 knockdown versus control cells with various concentrations of chemotherapeutic agents.

  • Cell death assays: Measuring apoptosis rates in LEMD1-modified cells after drug treatment.

  • Drug resistance marker analysis: Evaluating changes in established drug resistance markers after LEMD1 modulation.

These findings suggest that targeting LEMD1 might be a promising approach to enhance the efficacy of conventional chemotherapy in cancer treatment.

What transcriptional regulators control LEMD1 expression?

The transcriptional regulation of LEMD1 has been investigated in several cancer types, with SOX4 (SRY-related high-mobility-group box 4) emerging as a key regulator:

  • SOX4 regulation: In colon cancer, SOX4 has been identified as a transcriptional activator of LEMD1 . The JASPAR database predicted potential binding sites between SOX4 and the LEMD1 promoter .

  • Experimental validation: Luciferase reporter and ChIP assays have confirmed the interaction between SOX4 and the LEMD1 promoter . SOX4 elevation can reverse the suppressive effects of LEMD1 deletion on colon cancer development and signaling pathway activation .

  • Correlation in cancer tissues: The GEPIA database analysis revealed a positive correlation between SOX4 and LEMD1 expression in colon cancer tissues .

  • Epigenetic regulation: While not explicitly mentioned in the search results, methylation analysis has been performed for LEMD1 using the DNMIVD database, suggesting potential epigenetic regulation of LEMD1 expression .

Understanding these regulatory mechanisms provides insights into the upstream control of LEMD1 expression and may reveal additional therapeutic targets for cancers with aberrant LEMD1 expression.

What are the optimal conditions for producing recombinant LEMD1 protein?

For producing recombinant LEMD1 protein, researchers commonly use expression systems based on the following parameters:

  • Expression system: E. coli or mammalian expression systems are typically employed depending on the study requirements. For structural and biochemical studies, bacterial systems often suffice, while mammalian systems may better preserve post-translational modifications.

  • Protein fragment: The recombinant fragment protein corresponding to Human LEMD1 typically spans from amino acid 1 to the C-terminus .

  • Purification tags: His-tags or GST-tags are commonly added to facilitate purification through affinity chromatography.

  • Storage conditions: Purified recombinant LEMD1 should be stored at -80°C in appropriate buffer conditions containing stabilizers like glycerol.

  • Quality control: Proper folding and activity should be verified through techniques such as circular dichroism (CD) spectroscopy or functional assays before using the recombinant protein in experiments.

It's important to note that commercial sources often provide recombinant LEMD1 fragments suitable for specific applications like antibody generation or enzyme assays .

What animal models are appropriate for studying LEMD1 function in vivo?

Based on the available research, the following animal models have proven effective for studying LEMD1 function in vivo:

  • Xenograft mouse models: 5-week-old female BALB/c nude mice have been successfully used for subcutaneous injection of cancer cells with modified LEMD1 expression . This model is particularly suitable for studying the effects of LEMD1 on tumor growth and progression.

  • Protocol details:

    • Cell preparation: 1 × 10^6 cancer cells (e.g., MDA-MB-231 with stable LEMD1 knockdown or control cells) in 100 μL medium are typically injected subcutaneously .

    • Monitoring: Tumor sizes and body weights are measured every other day, with tumor volume calculated as length × width^2 × (π/6) .

    • Endpoint analysis: At the experiment's termination, subcutaneous tumors are excised, weighed, and analyzed .

  • Considerations for future model development:

    • Transgenic models: Conditional knockout or overexpression of LEMD1 in specific tissues could provide insights into its role in cancer initiation.

    • Orthotopic models: Implanting modified cancer cells directly into the organ of origin may better recapitulate the tumor microenvironment.

    • Patient-derived xenograft (PDX) models: These could be used to study LEMD1 in the context of maintaining tumor heterogeneity.

Animal studies should comply with institutional guidelines and follow the principles outlined in ethics approvals, such as those mentioned in accordance with the Helsinki Declaration .

How can LEMD1 be targeted for potential therapeutic applications?

Several approaches for targeting LEMD1 for therapeutic applications can be considered:

  • RNA interference-based therapies:

    • siRNA or shRNA targeting LEMD1 has shown promise in preclinical models by inhibiting cancer cell proliferation, migration, and invasion .

    • Delivery challenges must be addressed through appropriate nanoparticle formulations or other carrier systems.

  • Antibody-based approaches:

    • Anti-LEMD1 antibodies could be developed for therapeutic applications, potentially conjugated with cytotoxic agents for targeted delivery to cancer cells .

    • The cancer-testis antigen (CTA) nature of LEMD1 makes it an attractive target due to its limited expression in normal tissues .

  • Small molecule inhibitors:

    • Identifying small molecules that disrupt LEMD1's interaction with downstream signaling proteins (ERK, PI3K/Akt, or RhoA/ROCK pathways) could be effective .

  • Combination therapy approaches:

    • LEMD1 inhibition could sensitize cancer cells to conventional chemotherapeutics like paclitaxel .

    • Combining LEMD1 targeting with inhibitors of complementary pathways might enhance therapeutic efficacy.

  • Immunotherapy:

    • As a cancer-testis antigen, LEMD1 could potentially serve as a target for cancer vaccines or adoptive T-cell therapies.

The development of these therapeutic strategies requires further investigation of LEMD1's structural characteristics and molecular interactions to identify druggable sites or vulnerable interactions.

What are emerging applications of LEMD1 as a cancer biomarker?

LEMD1 has significant potential as a cancer biomarker in several applications:

  • Prognostic biomarker: High LEMD1 expression is consistently associated with poor prognosis across multiple cancer types, including TNBC, colorectal cancer, gastric cancer, and pancreatic cancer .

  • Recurrence prediction: A three-gene signature including LEMD1, SERPINE1, and SIAE has been developed to predict colorectal cancer relapse . Patients with low expression of LEMD1 have been shown to have shorter disease-free survival and lower risk of postoperative recurrence .

  • Therapy response prediction: LEMD1 expression may predict response to chemotherapy, as knockdown of LEMD1 renders TNBC cells more sensitive to paclitaxel . The ROC plotter server has been used to analyze the influence of LEMD1 expression on anti-cancer drug resistance .

  • Methylation analysis: LEMD1 methylation levels have been analyzed using the DNMIVD database to assess their relationship with patient survival , suggesting epigenetic modifications of LEMD1 might also serve as biomarkers.

  • Multi-gene panels: LEMD1 could be incorporated into multi-gene signatures for improved predictive power, as demonstrated by the three-gene signature for colorectal cancer relapse .

For clinical implementation, standardized methods for LEMD1 detection and quantification in both tissue samples and liquid biopsies need to be developed and validated in larger cohorts.

What are the most pressing research questions regarding LEMD1?

Several critical research questions about LEMD1 remain unanswered and warrant further investigation:

  • Structural biology: What is the detailed three-dimensional structure of LEMD1, and how does it mediate interactions with its downstream effectors?

  • Signaling integration: How does LEMD1 coordinate activities across multiple signaling pathways (ERK, PI3K/Akt, RhoA/ROCK), and what are the key interaction partners mediating these effects?

  • Tissue specificity: Why does LEMD1 show oncogenic effects in specific cancer types, and are there tissue-specific cofactors that determine its function?

  • Regulatory mechanisms: Beyond SOX4, what other transcription factors and epigenetic mechanisms regulate LEMD1 expression in different contexts?

  • Therapeutic targeting: What are the most effective approaches to target LEMD1 for cancer therapy, and how can these be translated to clinical applications?

  • Resistance mechanisms: Do cancer cells develop compensatory mechanisms upon LEMD1 inhibition, and how can these be addressed in therapeutic strategies?

  • Biomarker validation: Can LEMD1 expression or its downstream effects be reliably measured in clinical samples for biomarker applications?

Answering these questions will require coordinated efforts using advanced technologies and multidisciplinary approaches spanning structural biology, molecular biology, cell biology, and translational research.

What methodological advances would accelerate LEMD1 research?

To advance LEMD1 research more rapidly, several methodological innovations would be valuable:

  • Single-cell analysis: Applying technologies like latent embedding multivariate regression (LEMUR) for single-cell RNA-seq analysis could identify cell populations with differential LEMD1 expression or response to LEMD1 modulation, providing insights into heterogeneous effects within tumors.

  • CRISPR-based approaches: Genome-wide CRISPR screens to identify synthetic lethal interactions with LEMD1 could reveal new therapeutic vulnerabilities in LEMD1-expressing cancers.

  • Structural biology techniques: Cryo-EM, X-ray crystallography, or NMR studies of LEMD1 and its complexes would provide crucial insights for rational drug design.

  • Organoid models: Patient-derived organoids with manipulated LEMD1 expression could provide more physiologically relevant models than traditional cell lines.

  • Conditional knockout models: Generating tissue-specific and inducible LEMD1 knockout mouse models would allow for more nuanced studies of LEMD1's role in cancer initiation and progression.

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics approaches to comprehensively understand LEMD1's effects on cellular physiology.

  • Advanced imaging: Live-cell imaging techniques to track LEMD1 localization and dynamics in response to various stimuli and during cell cycle progression.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.