Recombinant Human Leucine-rich repeat-containing protein 24 (LRRC24)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Human Leucine-rich repeat-containing protein 24 (LRRC24) is a protein-coding gene in humans . The gene ID for LRRC24 is 441381, and it was last updated on January 4, 2025 .

Leucine-Rich Repeats (LRRs)

LRRC24 contains leucine-rich repeats (LRRs), which are evolutionarily conserved domains found in many proteins associated with innate immunity in plants, invertebrates, and vertebrates . LRRs typically consist of 20–30 residues and can range from 2 to 45 repeats within a protein . These repeats form an arc or horseshoe shape, with a concave face of parallel $$ \beta $$-strands and a more variable convex face .

Structure and Function of LRRs

LRRs are essential structural frameworks for molecular interactions and pattern recognition, particularly in Toll-like receptors (TLRs) and NOD-like receptors (NLRs) . TLRs and NLRs use their LRR domains to sense molecular determinants from various bacterial, fungal, parasite, and viral components .

LRR Protein Classification

LRR proteins can be grouped based on the similarity of their LRR domains. Hidden Markov models (HMMs) classify each repeat sequence within an LRR domain into seven regular classes: S, RI, CC, SDS22, PS, T, and Tp . Pattern-matching algorithms identify predicted secondary structures and atypical LRR sequences adjacent to regular LRRs .

Expression of LRRC24

Expression of the LRRC24 mRNA can be influenced by various factors . For example, in rats, a combination of methionine, choline, folic acid, betaine, Vitamin B12, zinc, and phenobarbital increases LRRC24 mRNA expression, while a deficiency in methionine, choline, and folic acid decreases methylation of the LRRC24 gene . Additionally, cisplatin decreases LRRC24 mRNA expression in rats .

The table below summarizes factors influencing LRRC24 mRNA expression in rats :

FactorEffect on LRRC24 mRNA Expression
Methionine, Choline, Folic Acid, Betaine, Vitamin B12, Zinc, PhenobarbitalIncreased expression
Methionine deficiency, Choline deficiency, Folic Acid deficiencyDecreased methylation
CisplatinDecreased expression
Dichloroacetic AcidIncreased expression
EndosulfanIncreased expression
FuranIncreased expression
MethidathionIncreased expression
N-nitrosodiethylamine (Diethylnitrosamine)Increased expression
Paracetamol (Acetaminophen)Increased expression
Pirinixic acidIncreased expression
Propanal (Propionaldehyde)Increased expression
SunitinibIncreased expression
Tetrachloroethene (Tetrachloroethylene)Increased expression
Maneb co-treated with ParaquatDecreased expression
SomanDecreased expression
Titanium dioxideDecreased methylation

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure contents settle. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us; we will prioritize its development.
Synonyms
LRRC24; Leucine-rich repeat-containing protein 24
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-513
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
LRRC24
Target Protein Sequence
AGCPAACRCYSATVECGALRLRVVPLGIPPGTQTLFLQDNNIARLEPGALAPLAALRRLY LHNNSLRALEAGAFRAQPRLLELALTSNRLRGLRSGAFVGLAQLRVLYLAGNQLARLLDF TFLHLPRLQELHLQENSIELLEDQALAGLSSLALLDLSRNQLGTISREALQPLASLQVLR LTENPWRCDCALHWLGAWIKEGGQRLLTSRDRKIMCAEPPRLALQSLLDVSHSSLICIPP SVHVQPLELTANLGEDLRVACQASGYPQPLVTWRKVPQPREGRPRAQAQLEGGLLGLGGH SASDTGSGMLFLSNITLAHAGKYECEASNAGGAARVPFRLLVNASRQQPQQPAQPPPPAA RPAGSEPRPEAGSMAFRALGVATQTAIAAAIALLALTALLLVAMICRRRRRRKKARGPPG EGALFVNDYLDGPCTFAQLEELRDERGHEMFVINRSKPLFAEGPAEAPADCGPEQGAGPG LRVPPPVAYEIHC
Uniprot No.

Target Background

Database Links

HGNC: 28947

KEGG: hsa:441381

STRING: 9606.ENSP00000434849

UniGene: Hs.740859

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is LRRC24 and what structural features characterize this protein?

LRRC24 (Leucine-rich repeat-containing protein 24) is a type I transmembrane protein belonging to the broader LRR superfamily. Structurally, mature human LRRC24 spans from Cys23 to Ser365 and contains multiple leucine-rich repeat (LRR) domains within its extracellular domain (ECD) . The protein also features an Ig-like C2-type region in its ECD that contributes to its functional capabilities . When working with recombinant versions, researchers typically utilize constructs that include a C-terminal His-tag for purification purposes . To characterize the structural features experimentally, combining crystallography with molecular dynamics simulation provides the most comprehensive analysis of domain organization and potential binding interfaces.

How conserved is LRRC24 across species and what does this suggest about functional importance?

The extracellular domain of human LRRC24 demonstrates significant evolutionary conservation, sharing 86% amino acid sequence identity with mouse LRRC24 and 80% with rat LRRC24 . This high degree of conservation across mammalian species strongly suggests functional importance in conserved biological pathways. To investigate conservation experimentally, researchers should conduct multiple sequence alignments followed by identification of conserved motifs, particularly within the LRR domains. Functional conservation can be validated through complementation assays in which human LRRC24 is expressed in knockout models from other species to assess rescue of phenotypes.

What are the established functional roles of LRRC24 in cellular processes?

LRRC24 has been implicated in several critical cellular processes based on experimental evidence. The protein interacts with Robo2, a receptor involved in axon guidance and cell migration mechanisms, suggesting a role in neural development . Additionally, LRRC24 functions as a negative regulator of the ErbB family of receptor tyrosine kinases, thereby suppressing ErbB-driven tumor cell proliferation and motility . To characterize these functions, researchers should employ both gain-of-function and loss-of-function approaches, tracking phenotypic changes in relevant cell types through proliferation assays, migration assays, and in vitro models of neuronal development.

How should researchers design experiments to investigate LRRC24-Robo2 interactions?

When investigating LRRC24-Robo2 interactions, proper experimental design is critical for generating reliable data. Begin by clearly defining independent variables (e.g., LRRC24 expression levels, presence of mutations in interaction domains) and dependent variables (e.g., binding affinity, downstream signaling activation) . Co-immunoprecipitation experiments should include appropriate negative controls using LRRC24 constructs with mutations in predicted binding regions. For quantitative assessment, surface plasmon resonance or microscale thermophoresis provides binding kinetics data. Cell-based assays should employ both overexpression and knockdown approaches in relevant neural cell models, with attention to potential confounding variables such as expression of other Robo family members .

What methodological approaches are recommended for studying LRRC24's inhibitory effects on ErbB signaling?

To rigorously examine LRRC24's role in ErbB signaling regulation, researchers should design experiments with clearly defined endpoints that measure both direct interaction and functional consequences. Implement a multi-tiered approach beginning with protein-protein interaction studies using purified recombinant proteins (LRRC24-His tag constructs) . Follow with cell-based assays comparing ErbB phosphorylation status and downstream signaling (e.g., MAPK pathway activation) in the presence and absence of LRRC24. Control variables must include standardized expression levels of both LRRC24 and ErbB family members . To assess functional outcomes, measure cell proliferation using real-time cell analysis systems and cell motility through wound healing or transwell migration assays, with appropriate statistical analysis comparing treatment and control conditions.

How can researchers effectively use LASSO regression to identify gene networks associated with LRRC24 function?

When applying LASSO regression to identify gene networks related to LRRC24 function, researchers should follow a systematic analytical workflow. First, collect comprehensive gene expression data from relevant experimental conditions (LRRC24 overexpression, knockdown, and controls) . Prior to analysis, normalize the expression data using appropriate methods to minimize batch effects and technical variations. Apply LRRC24 as a primary variable and implement LASSO regression with cross-validation to determine the optimal lambda (λ) value that minimizes mean square error . This approach will identify genes with non-zero coefficients that are significantly associated with LRRC24 expression or activity. Following identification of these genes, validate the predicted relationships through targeted experiments using qRT-PCR and protein interaction studies . The validated gene network will provide insight into the broader biological context of LRRC24 function.

What cell models are most appropriate for studying LRRC24 functions, and how should they be validated?

Selection of appropriate cell models for LRRC24 research requires consideration of both endogenous expression patterns and functional relevance. Based on LRRC24's roles in neural development and tumor suppression, neuronal cell lines and cancer cell models (particularly those with ErbB overexpression) represent logical choices . Prior to experimental use, validate endogenous LRRC24 expression in candidate cell lines using qRT-PCR with properly designed primers specific to LRRC24 . Western blot analysis with validated antibodies should confirm protein expression. For overexpression studies, transfection efficiency must be quantified and standardized across experimental conditions . When establishing knockdown models, validate siRNA efficiency through both mRNA and protein quantification, selecting constructs with >70% knockdown efficiency while monitoring potential off-target effects .

What are the optimal methods for detecting and quantifying LRRC24 protein expression levels?

For reliable detection and quantification of LRRC24 protein, implement a multi-method approach tailored to experimental requirements. Western blot analysis using validated antibodies provides semi-quantitative assessment of total LRRC24 protein levels, with β-actin serving as a loading control . Quantify band intensity using ImageJ or similar software, with technical replicates to ensure reproducibility . For subcellular localization, immunofluorescence microscopy with co-staining of membrane markers helps determine proper trafficking of this transmembrane protein. Flow cytometry can quantify surface expression levels in intact cells, particularly useful when comparing mutant forms or assessing internalization kinetics. For absolute quantification, develop a standard curve using purified recombinant LRRC24-His tag protein of known concentration .

What qRT-PCR protocols should be used to accurately measure LRRC24 mRNA expression?

To accurately measure LRRC24 mRNA expression, implement a standardized qRT-PCR protocol beginning with high-quality RNA extraction using validated commercial kits . Design gene-specific primers that span exon-exon junctions to prevent genomic DNA amplification, with amplicon sizes of 80-150 base pairs for optimal amplification efficiency . Prior to experimental analysis, validate primers through melt curve analysis and efficiency testing using standard curves. Use a two-step RT-PCR protocol with SYBR Green chemistry, including no-template and no-RT controls to detect potential contamination . Select appropriate reference genes (such as GAPDH) after stability testing across experimental conditions . For analysis, apply the comparative Ct method (2^-ΔΔCt) for relative quantification, with statistical analysis using appropriate tests (t-test for two-group comparisons or ANOVA for multiple groups) .

How should researchers reconcile conflicting data regarding LRRC24 function across different experimental systems?

When confronted with contradictory findings about LRRC24 function, implement a systematic approach to data reconciliation. First, critically evaluate experimental design differences including cell types, expression levels, and assay conditions that might explain divergent results . Perform comprehensive literature review to identify patterns in findings across research groups. Design validation experiments that directly address discrepancies, including side-by-side comparison of different cell models under identical conditions. Consider context-dependent protein function by examining interaction partners present in different experimental systems. Quantitative analysis using statistical methods appropriate for meta-analysis can help determine significance of observed differences . When publishing results, clearly acknowledge contradictions in the literature and provide detailed methodological information to facilitate reproducibility.

What statistical approaches are most appropriate for analyzing the effects of LRRC24 manipulation on cell phenotypes?

Statistical analysis of LRRC24 manipulation experiments should match the experimental design and data characteristics. For comparing means between control and experimental groups (e.g., wild-type vs. LRRC24 overexpression), apply t-tests for normally distributed data or non-parametric alternatives (Mann-Whitney) when assumptions are violated . When examining multiple conditions, use ANOVA followed by appropriate post-hoc tests with correction for multiple comparisons . For time-dependent effects, repeated measures ANOVA or mixed effects models provide robust analysis. All experiments should include sufficient biological replicates (minimum n=3) and technical replicates to ensure statistical power . Present data with appropriate error bars (standard deviation for data distribution or standard error for precision of mean estimation) and exact p-values rather than threshold indicators .

How can dose-response relationships between LRRC24 expression levels and cellular phenotypes be properly analyzed?

To rigorously analyze dose-response relationships between LRRC24 expression and cellular outcomes, implement titrated expression systems and appropriate mathematical modeling. Design experiments with graduated expression levels of LRRC24, verified by qRT-PCR and Western blot quantification . For each expression level, measure relevant phenotypic outcomes such as cell proliferation, migration rates, or ErbB phosphorylation status. Plot dose-response curves and fit appropriate mathematical models (linear, sigmoidal, or biphasic) based on data characteristics . Calculate EC50 or IC50 values to quantify sensitivity, and compare these metrics across different cell types or experimental conditions . Address potential confounding variables through multivariate analysis, particularly when working with complex phenotypes. For accurate comparison between experiments, normalize LRRC24 expression to a standard reference point or to fold-change over baseline expression.

What protein interaction techniques provide the most reliable data for identifying LRRC24 binding partners?

For comprehensive identification and validation of LRRC24 binding partners, researchers should employ a multi-technique strategy. Begin with co-immunoprecipitation using tagged recombinant LRRC24 protein (such as LRRC24-His) , followed by mass spectrometry to identify interacting proteins without bias. Validate primary findings through reciprocal co-immunoprecipitation and proximity ligation assays in intact cells. For direct binding assessment and kinetic analysis, surface plasmon resonance or biolayer interferometry using purified proteins provides quantitative binding parameters. FRET or BRET approaches enable real-time monitoring of protein interactions in living cells. For each method, include appropriate negative controls (mutated binding domains) and positive controls (known interactors such as Robo2) . Data from multiple complementary techniques should be integrated to establish confidence in protein interaction networks.

How should researchers design experiments to investigate LRRC24's role in tumor suppression?

To investigate LRRC24's potential tumor suppressive functions, design a comprehensive experimental approach spanning in vitro and in vivo models. Begin with expression analysis comparing LRRC24 levels in tumor versus normal tissue across multiple cancer types . Establish stable cell lines with controlled LRRC24 expression (overexpression in low-expressing lines and knockdown in high-expressing lines) . Measure hallmarks of malignancy including proliferation (through real-time cell analysis systems), apoptosis resistance (using flow cytometry with Annexin V/PI staining), migration and invasion (through transwell assays), and anchorage-independent growth (via soft agar colony formation). Analyze effects on ErbB signaling through phospho-specific antibodies to detect activation status of receptors and downstream effectors . For in vivo validation, implement xenograft models comparing tumor growth rates and metastatic potential between LRRC24-modified and control cells, with careful attention to sample size calculation for adequate statistical power.

What approaches should be used to assess the therapeutic potential of modulating LRRC24 activity?

To evaluate LRRC24 as a potential therapeutic target, implement a staged research program progressing from mechanistic studies to therapeutic modeling. First, establish clear causal relationships between LRRC24 modulation and disease-relevant phenotypes through genetic approaches (overexpression/knockdown) . Develop small molecule or peptide-based modulators of LRRC24 activity, targeting either its expression or key protein-protein interactions. Screen candidates using biochemical assays followed by cellular assays measuring functional endpoints. For promising candidates, determine IC50 values through dose-response experiments in relevant cell models . Conduct combination studies with standard therapeutics (particularly ErbB-targeting agents given LRRC24's regulatory role) to identify potential synergistic effects. Progress to appropriate disease models, with pharmacokinetic and pharmacodynamic studies to establish target engagement and efficacy. Throughout development, maintain focus on biomarker identification that could predict response to LRRC24-modulating therapies in potential clinical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.