Recombinant Human Leucine-rich repeat-containing protein 3B (LRRC3B)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
LRRC3B; LRP15; UNQ195/PRO221; Leucine-rich repeat-containing protein 3B; Leucine-rich repeat protein 15
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
34-259
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
LRRC3B
Target Protein Sequence
CPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVL NLSKNGIEFIDEHAFKGVAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTL QQVLRSMASNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYAMLVTMFGW FTMVISYVVYYVRQNQEDARRHLEYLKSLPSRQKKADEPDDISTVV
Uniprot No.

Target Background

Gene References Into Functions

LRRC3B Function and Clinical Significance:

  1. LRRC3B expression is downregulated in non-small cell lung cancer (NSCLC) compared to normal epithelial cells. (PMID: 27118644)
  2. LRRC3B may function as a tumor suppressor in NSCLC. (PMID: 26276358)
  3. LRRC3B gene expression and promoter hypermethylation have been observed in breast carcinomas. (PMID: 24839112)
  4. Evidence suggests LRRC3B acts as a tumor suppressor gene involved in carcinogenesis. (PMID: 22321817)
  5. LRRC3B gene promoter methylation was detected in 43% of clear cell renal carcinoma samples. (PMID: 22101383)
  6. LRP15 expression is methylation-controlled in HeLa cells, conferring UV resistance and accelerated DNA repair. (PMID: 18377727)
  7. LRRC3B, a potential tumor suppressor gene, is silenced epigenetically in gastric cancers, potentially impacting immune evasion. (PMID: 18757430)
  8. LRRC3B is a possible methylation-sensitive tumor suppressor in colorectal cancer (CRC), with methylation serving as a potential biomarker. (PMID: 18815942)
Database Links

HGNC: 28105

KEGG: hsa:116135

STRING: 9606.ENSP00000379880

UniGene: Hs.517868

Protein Families
LRRC3 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the basic structure and function of LRRC3B?

LRRC3B contains a leucine-rich repeat N-terminal domain with conserved regions at cAMP- and cGMP-dependent protein kinase phosphorylation sites. The protein is primarily localized to the extracellular membrane with protein post-translational modifications, particularly N-methylation. These structural characteristics enable LRRC3B to participate in cell differentiation, cycle regulation, proliferation, invasion, and signal transduction . The protein's topology is critical for its tumor suppressor functions, as it mediates interactions with other proteins involved in cellular growth control pathways.

How is LRRC3B expression regulated in normal tissues versus cancer tissues?

LRRC3B expression is significantly lower in tumor tissues compared to adjacent normal tissues across multiple cancer types, including breast cancer, lung cancer, gastric cancer, renal cancer, and colorectal cancer . This downregulation occurs through various mechanisms, with DNA methylation at the LRRC3B promoter region being particularly important. Research has demonstrated that the methylation level of specific CpG sites within the LRRC3B promoter strongly correlates with reduced mRNA expression . For instance, analysis of cancer cell lines such as H1299 (lung cancer) and Hs578T (breast cancer) revealed that LRRC3B levels were barely detectable by qPCR compared to normal cells, confirming its suppression in cancerous states .

What experimental methods are most effective for detecting LRRC3B expression in tissue samples?

For detecting LRRC3B expression in tissue samples, researchers should employ multiple complementary approaches for comprehensive assessment:

  • qPCR for mRNA expression analysis: This technique has been successfully used to measure LRRC3B mRNA levels in cancer cell lines, though expression can be very low in certain cancer cells (H1299 and Hs578T) .

  • Immunoblotting for protein expression: Western blotting has proven effective for comparing LRRC3B protein expression between normal epithelial cells and cancer cells .

  • Immunohistochemistry: For tissue-level analysis, IHC provides spatial information about LRRC3B expression patterns.

  • RNA-sequencing: For broader transcriptome analysis, RNA-seq data from repositories like TCGA can be analyzed to compare LRRC3B expression across different cancer types versus normal tissues .

  • Methylation analysis: Using methylation-specific PCR or bisulfite sequencing to assess the methylation status of the LRRC3B promoter region, which correlates with expression levels.

Which LRRC3B single nucleotide polymorphisms (SNPs) are associated with cancer susceptibility?

Research has identified multiple LRRC3B SNPs associated with cancer susceptibility, particularly in breast cancer. The most significant associations include:

  • rs1907168: The T allele of this SNP is associated with a decreased risk of breast cancer (OR = 0.77, 95% CI: 0.61–0.99, p = 0.037). This protective effect was observed across multiple genetic models, including heterozygous (OR = 0.71, 95% CI: 0.54–0.94, p = 0.017), dominant (OR = 0.72, 95% CI: 0.55–0.95, p = 0.019), and log-additive (OR = 0.76, 95% CI: 0.59–0.97, p = 0.030) models .

  • rs78205284: The TT genotype of this polymorphism was found to contribute to increased breast cancer risk specifically in younger populations (age ≤51 years), with significant associations in the recessive model (TT vs. GG, OR = 2.83, 95% CI: 1.08–7.41, p = 0.034) and the homozygote comparison (TT vs. GG-GT, OR = 2.72, 95% CI: 1.05–7.07, p = 0.040) .

These findings suggest that genetic variations in LRRC3B contribute to individual susceptibility to breast cancer, particularly with age-specific effects, making them potential markers for risk assessment.

How should researchers design case-control studies to investigate LRRC3B polymorphisms in different populations?

When designing case-control studies to investigate LRRC3B polymorphisms:

  • Sample Size and Power Calculation:

    • Calculate adequate sample size based on expected effect sizes from previous studies (e.g., ORs ranging from 0.7 to 2.8 for different SNPs)

    • Include power analysis to ensure the ability to detect meaningful associations

  • Population Selection:

    • Clearly define case and control groups with matched demographic characteristics

    • Consider age stratification, as some LRRC3B polymorphisms show age-specific effects (e.g., rs1907168 showed stronger associations in participants under 51 years)

    • Account for ethnic differences, as the original findings were from a Chinese Han population

  • Genotyping Methodology:

    • Use reliable high-throughput genotyping platforms

    • Include quality control measures such as duplicate sampling and Hardy-Weinberg equilibrium testing

    • Consider targeted sequencing of the entire LRRC3B gene to identify novel variants

  • Clinical Data Collection:

    • Gather comprehensive clinical parameters including hormone receptor status, proliferation markers (e.g., Ki67), and tumor characteristics, as these have shown associations with LRRC3B polymorphisms

  • Statistical Analysis Approach:

    • Apply logistic regression analysis with adjustments for age, gender, and other confounding factors

    • Analyze under multiple genetic models (allelic, genotypic, dominant, recessive, and log-additive)

    • Implement correction for multiple testing (e.g., Bonferroni correction) as demonstrated in previous studies

    • Consider haplotype analysis to identify combinatorial effects of multiple SNPs

What bioinformatic tools are recommended for predicting the functional impact of LRRC3B variants?

For predicting the functional impact of LRRC3B variants, researchers should utilize a multi-layered bioinformatic approach:

  • Variant Effect Prediction Tools:

    • SIFT and PolyPhen-2 for assessing amino acid substitution effects

    • MutationTaster for evaluating evolutionary conservation and potential pathogenicity

    • CADD (Combined Annotation-Dependent Depletion) for integrative scoring of variant deleteriousness

  • Structural Impact Analysis:

    • I-TASSER or AlphaFold for protein structure prediction

    • SWISS-MODEL for homology modeling

    • PyMOL or UCSF Chimera for visualization and analysis of structural changes

    • FoldX for calculating free energy changes caused by mutations

  • Regulatory Element Analysis:

    • JASPAR and TRANSFAC for transcription factor binding site prediction

    • RegulomeDB for annotating variants with known and predicted regulatory elements

    • HaploReg for exploring annotations of variants on haplotype blocks

  • Splicing Impact Assessment:

    • SpliceAI and MaxEntScan for predicting effects on RNA splicing

    • ESEfinder for identifying exonic splicing enhancers

  • Methylation Impact Analysis:

    • MethPrimer for designing methylation-specific PCR primers

    • UCSC Genome Browser methylation tracks for visualizing CpG islands

    • MethylationEPIC array data analysis for genome-wide methylation profiling

  • Integrated Analysis Platforms:

    • Ensembl Variant Effect Predictor (VEP) for comprehensive annotation

    • ANNOVAR for functional annotation of genetic variants

    • Genomic Data Commons data portal for accessing TCGA methylation and expression data to correlate with LRRC3B variants

How does LRRC3B promoter methylation affect gene expression and cancer progression?

LRRC3B promoter methylation is a key epigenetic mechanism that silences this tumor suppressor gene, directly impacting cancer development and progression:

The comprehensive effects of LRRC3B promoter methylation highlight its critical role in the molecular pathogenesis of cancer and suggest its potential as both a biomarker and therapeutic target.

What methodologies should be employed to accurately measure LRRC3B methylation status in clinical samples?

For accurate assessment of LRRC3B methylation status in clinical samples, researchers should consider these methodological approaches:

  • Bisulfite Conversion-Based Methods:

    • Bisulfite Sequencing PCR (BSP): For detailed single-nucleotide resolution of methylation across the entire LRRC3B promoter region

    • Methylation-Specific PCR (MSP): For targeted analysis of specific CpG sites

    • Pyrosequencing: For quantitative assessment of methylation levels at individual CpG sites

    • Illumina Methylation Arrays (450K or EPIC): For genome-wide methylation profiling that includes LRRC3B promoter CpGs. This approach was used in TCGA analyses referenced in the research

  • Enrichment-Based Methods:

    • Methylated DNA Immunoprecipitation (MeDIP): For capturing methylated DNA fragments

    • Methyl-CpG Binding Domain (MBD) protein capture: For isolating methylated DNA regions

  • Clinical Sample Handling:

    • Use fresh-frozen tissue when possible for best DNA quality

    • For FFPE samples, employ specialized DNA extraction kits designed for fragmented DNA

    • Include matched normal tissue controls for comparative analysis

    • Consider microdissection to enrich for tumor cells in heterogeneous samples

  • Analytical Considerations:

    • Focus on the specific CpG sites that showed differential methylation between tumor and normal tissues (p<0.05)

    • Implement the silencing score model described in research: Silencing Score = Σ(βi × Mi), where βi represents the coefficient index and Mi represents the methylation level

    • Calculate Spearman correlation between the silencing score and LRRC3B mRNA expression to validate the functional impact

  • Quality Control:

    • Include universal methylated and unmethylated controls

    • Assess bisulfite conversion efficiency (>98% recommended)

    • Perform technical replicates for validation

    • Normalize data using appropriate housekeeping regions

These methodologies provide a comprehensive framework for accurate LRRC3B methylation analysis in both research and potential clinical applications.

How can LRRC3B methylation patterns be integrated with other biomarkers for cancer prognosis modeling?

Integrating LRRC3B methylation patterns with other biomarkers requires a sophisticated multi-omics approach:

  • Multi-omics Data Integration Framework:

    • Combine LRRC3B methylation data with other omics datasets (transcriptomics, genomics, proteomics)

    • Apply dimensionality reduction techniques (PCA, t-SNE) to identify patterns across datasets

    • Use supervised machine learning approaches (Random Forest, Support Vector Machines) to build predictive models

  • Complementary Biomarker Selection:

    • Incorporate immune cell infiltration markers that correlate with LRRC3B expression

    • Include key signaling pathway components identified through GSEA Java analysis

    • Add clinical parameters that showed significant association with LRRC3B polymorphisms (PR status, Ki67 status, tumor size)

  • Methodological Integration Approaches:

    • Cox Proportional Hazards modeling incorporating the LRRC3B silencing score with other biomarkers

    • Consensus clustering based on DNA methylation patterns

    • Development of a weighted risk score incorporating multiple parameters

  • Validation Strategy:

    • Use independent cohorts such as GSE119144 and GSE72308 for validation

    • Apply cross-validation techniques (k-fold, leave-one-out) to assess model robustness

    • Test model performance in different cancer types to assess generalizability

  • Clinical Implementation Considerations:

    • Develop clinically practical assays for measuring the integrated biomarker panel

    • Define clear cutoff values for risk stratification using methods like X-tile

    • Create decision tree algorithms to guide treatment decisions based on the integrated model

One effective approach demonstrated in research is the construction of a silencing score based on LRRC3B promoter methylation combined with immune infiltration markers to predict response to anti-PD-1 therapy in non-small cell lung cancer and breast cancer .

How does LRRC3B expression influence the tumor immune microenvironment?

LRRC3B expression significantly shapes the tumor immune microenvironment through several mechanisms:

  • Immune Cell Infiltration:

    • LRRC3B expression shows significant correlation with six major immune cell types: B cells, CD8+ T cells, CD4+ T cells, macrophages, neutrophils, and dendritic cells

    • High LRRC3B expression is associated with increased infiltration of anti-tumor immune cells

    • Low expression correlates with immunosuppressive cell enrichment

  • Immunosuppressive Cell Modulation:

    • Inactivation of LRRC3B promotes the enrichment of immunosuppressive cells, including:

      • Myeloid-derived suppressor cells (MDSCs)

      • Cancer-associated fibroblasts (CAFs)

      • M2 subtype of tumor-associated macrophages (M2-TAMs)

      • Regulatory T (Treg) cells

    • This creates an environment conducive to tumor immune escape

  • Immune Checkpoint Interaction:

    • LRRC3B expression levels correlate with expression of immune checkpoint molecules

    • Silencing of LRRC3B is associated with changes in major histocompatibility complex (MHC) expression and immune activation genes

    • This relationship plays a role in T cell recognition and activation in the tumor microenvironment

  • Chemokine Regulation:

    • LRRC3B affects chemokine expression patterns that govern immune cell trafficking

    • Pearson correlation analysis revealed significant relationships between LRRC3B and immune-related genes

    • These alterations influence the recruitment and positioning of immune cells within the tumor

The multifaceted influence of LRRC3B on the tumor immune microenvironment underscores its importance as a potential target for improving immunotherapy efficacy.

What experimental models are optimal for studying LRRC3B's role in cancer immunology?

For studying LRRC3B's role in cancer immunology, researchers should consider these experimental models:

  • In Vitro Co-culture Systems:

    • Cancer cell-immune cell co-cultures with LRRC3B knockdown/overexpression

    • 3D organoid models incorporating immune components

    • Transwell migration assays to assess immune cell recruitment

    • CRISPR/Cas9-mediated LRRC3B editing in cancer cell lines followed by immune cell interaction studies

  • In Vivo Models:

    • Syngeneic mouse models with LRRC3B-modified cancer cells

    • Humanized mouse models engrafted with human immune cells

    • Patient-derived xenograft models in immunocompromised mice reconstituted with human immune components

    • CRISPR-engineered mouse models with conditional LRRC3B knockout in specific tissues

  • Ex Vivo Approaches:

    • Patient tumor explant cultures maintaining the original tumor microenvironment

    • Precision-cut tumor slices preserving tissue architecture and immune contexture

    • Flow cytometry and spatial transcriptomics to map immune cell distributions in relation to LRRC3B expression

  • Multi-omics Integration Methods:

    • Single-cell RNA sequencing to profile tumor and immune cell populations

    • CyTOF (mass cytometry) for high-dimensional immune profiling

    • Spatial proteomics using techniques like imaging mass cytometry or multiplexed ion beam imaging

    • Integration with methylation analysis to correlate LRRC3B silencing with immune phenotypes

  • Computational Models:

    • Agent-based modeling of tumor-immune interactions based on LRRC3B expression profiles

    • Network analysis using algorithms like CIBERSORTx for immune cell proportion estimation

    • TIMER analysis for assessing relationships between LRRC3B copy number alterations and immune infiltration

These complementary approaches provide a comprehensive toolkit for investigating the complex relationships between LRRC3B and the tumor immune microenvironment.

How can LRRC3B methylation status be utilized to predict response to immunotherapy?

LRRC3B methylation status has emerged as a promising predictor of immunotherapy response:

  • Predictive Modeling Framework:

    • Develop a silencing score based on LRRC3B promoter methylation levels at specific CpG sites

    • The formula Silencing Score = Σ(βi × Mi) integrates methylation levels (Mi) with coefficient indexes (βi)

    • Identify optimal cutoff values using statistical methods like X-tile to stratify patients into high and low methylation groups

  • Validation in Immunotherapy Cohorts:

    • The predictive value has been demonstrated in multiple immunotherapy datasets:

      • IMvigor210 cohort: Advanced/metastatic urothelial carcinoma patients treated with atezolizumab (anti-PD-L1)

      • GSE119144 and GSE72308 cohorts: Patients receiving anti-PD-1 treatment

    • Low LRRC3B methylation (high expression) correlates with improved response to checkpoint inhibitors

  • Mechanism-Based Rationale:

    • Low methylation/high expression of LRRC3B creates a favorable tumor immune microenvironment with:

      • Increased tumor-infiltrating lymphocytes

      • Decreased immunosuppressive cells (MDSCs, CAFs, M2-TAMs, Tregs)

      • Enhanced anti-tumor immune surveillance

    • This immune-favorable environment is more responsive to checkpoint blockade

  • Implementation Methodology:

    • Select specific CpG probes with differential methylation between responders and non-responders

    • Apply multivariate Cox regression analysis to construct the silencing score model

    • Perform survival analysis using Kaplan-Meier curves to demonstrate clinical benefit differences

    • Use Chi-Squared Test to analyze the proportional difference of clinical benefits between patient groups

  • Integration with Other Biomarkers:

    • Combine LRRC3B methylation status with:

      • PD-L1 expression levels

      • Tumor mutational burden (TMB)

      • Immune cell infiltration profiles

      • Gene expression signatures associated with immunotherapy response

The development of LRRC3B methylation as a predictive biomarker represents a significant advance in patient selection for immunotherapy, particularly in non-small cell lung cancer and breast cancer .

How might targeting LRRC3B expression or function be leveraged for novel cancer therapeutics?

Targeting LRRC3B represents a promising therapeutic avenue with multiple potential strategies:

  • Epigenetic Therapy Approaches:

    • DNA methyltransferase inhibitors (DNMTi) to reverse LRRC3B promoter hypermethylation

    • Histone deacetylase inhibitors (HDACi) to promote active chromatin states at the LRRC3B locus

    • Combination epigenetic therapy to synergistically restore LRRC3B expression

  • Gene Therapy Strategies:

    • Viral vector-mediated LRRC3B gene delivery to restore expression in tumors

    • CRISPR activation (CRISPRa) systems targeting the LRRC3B promoter to enhance endogenous expression

    • mRNA-based therapeutics delivering LRRC3B transcripts

  • Immunotherapy Enhancement:

    • Combining LRRC3B-targeting approaches with immune checkpoint inhibitors

    • Stratifying patients for immunotherapy based on LRRC3B methylation status

    • Developing CAR-T cells with enhanced function in LRRC3B-low tumor microenvironments

  • Small Molecule Modulators:

    • High-throughput screening to identify compounds that induce LRRC3B expression

    • Development of proteolysis-targeting chimeras (PROTACs) targeting proteins that repress LRRC3B

    • Small molecules that mimic LRRC3B signaling functions in tumor cells

  • Combination Therapies:

    • Based on IC50 analysis from GDSC, combining LRRC3B-targeting approaches with specific chemotherapeutic agents showing synergistic potential

    • Rational drug combinations addressing both LRRC3B and its downstream effector pathways

    • Sequential therapy regimens starting with epigenetic modifiers followed by targeted agents

These therapeutic strategies represent exciting directions for translational research, potentially addressing the unmet needs in cancers where LRRC3B dysregulation plays a significant role.

What challenges exist in developing recombinant LRRC3B protein for research applications?

Developing recombinant LRRC3B protein presents several technical challenges:

  • Protein Structure Complexity:

    • The leucine-rich repeat domains create complex folding patterns that are difficult to recapitulate in expression systems

    • Post-translational modifications, particularly N-methylation, are critical for proper function but challenging to reproduce in recombinant systems

    • The extracellular membrane localization requires appropriate processing of signal peptides and proper membrane targeting

  • Expression System Limitations:

    • Bacterial expression systems lack appropriate post-translational modification machinery

    • Mammalian expression systems often yield low protein quantities due to the natural low expression of LRRC3B

    • Insect cell systems may provide intermediate solutions but require optimization

    • Cell-free systems need extensive customization for complex membrane proteins

  • Purification Challenges:

    • Membrane protein solubilization requires careful detergent screening

    • Maintaining protein stability during purification processes

    • Achieving high purity without compromising structural integrity

    • Removing contaminating proteins while preserving LRRC3B function

  • Functional Validation Hurdles:

    • Limited knowledge of natural binding partners for activity assays

    • Complex readouts for tumor suppressor function

    • Need for specialized cell-based assays to confirm biological activity

    • Challenges in distinguishing specific from non-specific effects

  • Stability and Storage Issues:

    • Maintaining long-term stability without aggregation or degradation

    • Optimizing buffer conditions for research applications

    • Preserving function through freeze-thaw cycles

    • Determining appropriate concentrations for biological relevance

Addressing these challenges requires interdisciplinary approaches combining protein biochemistry, structural biology, and cancer biology expertise to develop research-grade recombinant LRRC3B preparations that faithfully represent the native protein's characteristics.

How can multi-omics data integration enhance our understanding of LRRC3B's role in different cancer types?

Multi-omics data integration offers powerful approaches to comprehensively understand LRRC3B's role across cancer types:

  • Genomic-Epigenomic-Transcriptomic Integration:

    • Correlate LRRC3B genetic variants (SNPs) with methylation patterns and expression levels

    • Identify cis- and trans-regulatory elements affecting LRRC3B expression

    • Map enhancer-promoter interactions using chromosome conformation capture technologies

    • This integration revealed that rs1907168 polymorphism affects both LRRC3B expression and susceptibility to breast cancer

  • Proteomics and Interactome Analysis:

    • Identify LRRC3B protein interactors through proximity labeling techniques

    • Characterize post-translational modifications affecting LRRC3B function

    • Develop protein-protein interaction networks to understand LRRC3B's molecular context

    • Connect interactome data with pathway enrichment to identify functional mechanisms

  • Clinical Data Integration:

    • Correlate LRRC3B status with clinical parameters across cancer types

    • Develop prognostic models incorporating genomic, epigenomic, and clinical variables

    • Stratify patients based on integrated LRRC3B-related signatures

    • This approach has successfully identified LRRC3B's association with tumor size, PR status, and Ki67 status in breast cancer

  • Tumor Microenvironment Analysis:

    • Integrate spatial transcriptomics and proteomics to map LRRC3B expression in relation to immune cell infiltration

    • Apply deconvolution algorithms like CIBERSORTx to estimate immune cell proportions

    • Correlate LRRC3B status with immunosuppressive cell enrichment across cancers

    • Connect these findings with response to immunotherapy as demonstrated in multiple cohorts

  • Advanced Computational Methods:

    • Apply machine learning algorithms to identify patterns across multi-omics datasets

    • Use network medicine approaches to position LRRC3B in disease modules

    • Implement causal inference methods to distinguish drivers from passengers

    • Develop predictive models incorporating LRRC3B silencing scores and other molecular features

This integrated approach has already yielded significant insights, including LRRC3B's role in predicting immunotherapy response in non-small cell lung cancer and breast cancer, and its association with specific polymorphisms that alter cancer susceptibility .

What are the most reliable cell and animal models for studying LRRC3B function?

For studying LRRC3B function, researchers should consider these validated models:

  • Cell Line Models:

    • Recommended Cancer Cell Lines:

      • Breast cancer: MCF-7, MDA-MB-231, Hs578T (with naturally low LRRC3B expression)

      • Lung cancer: H1299, A549 (with validated LRRC3B expression patterns)

      • Other validated lines: gastric cancer (AGS), colorectal cancer (HCT116), renal cancer (786-O)

    • Normal Cell Comparators:

      • Breast epithelial: MCF-10A, HMEC

      • Lung epithelial: BEAS-2B (effective for comparison with cancer lines)

      • Other matched normal cell types corresponding to cancer models

    • Genetic Modification Approaches:

      • CRISPR/Cas9 for LRRC3B knockout or activation

      • Lentiviral vectors for stable overexpression

      • Inducible expression systems for temporal control

      • Knockdown using validated siRNA or shRNA sequences

  • Animal Models:

    • Genetically Engineered Mouse Models:

      • Conditional LRRC3B knockout mice using tissue-specific Cre recombinase

      • LRRC3B overexpression transgenic models

      • CRISPR-engineered point mutations corresponding to human polymorphisms

    • Xenograft Models:

      • Orthotopic implantation of LRRC3B-modified cancer cells

      • Patient-derived xenografts with characterized LRRC3B status

      • Metastatic models to assess LRRC3B's role in invasion and dissemination

    • Syngeneic Models:

      • Mouse tumor cell lines with LRRC3B modification in immunocompetent hosts

      • Particularly valuable for studying immune interactions

  • Model Validation Approaches:

    • Expression Verification:

      • qPCR for mRNA quantification

      • Western blotting with validated antibodies

      • Immunohistochemistry for tissue localization

    • Functional Readouts:

      • Proliferation assays (e.g., MTT, BrdU incorporation)

      • Migration and invasion assays (wound healing, transwell)

      • Colony formation assays

      • Immune cell co-culture assays for microenvironment studies

When selecting models, researchers should consider the baseline LRRC3B expression level, methylation status, and relevant genetic background to ensure appropriate context for their specific research questions.

What are the current limitations in LRRC3B research and how might they be addressed?

LRRC3B research faces several key limitations that require strategic approaches:

  • Technical Challenges:

    • Limited Antibody Specificity:

      • Solution: Develop and validate new monoclonal antibodies

      • Alternative: Use epitope-tagged LRRC3B constructs

      • Approach: Apply multiplexed verification (Western blot, IP-MS, IF)

    • Low Endogenous Expression:

      • Solution: Use sensitive detection methods (digital PCR, RNAscope)

      • Alternative: Employ signal amplification techniques

      • Approach: Focus on models with detectable baseline expression

  • Knowledge Gaps:

    • Incomplete Understanding of Protein Interactions:

      • Solution: Apply proximity labeling (BioID, APEX) followed by MS

      • Alternative: Use high-throughput Y2H or protein arrays

      • Approach: Focus on context-specific interactomes in relevant cell types

    • Limited Functional Characterization:

      • Solution: Develop comprehensive phenotypic screens

      • Alternative: Apply domain-specific mutagenesis

      • Approach: Map structure-function relationships systematically

  • Methodological Limitations:

    • Inconsistent Methylation Analysis Methods:

      • Solution: Standardize approaches (specific region coverage, sequencing depth)

      • Alternative: Cross-validate with multiple techniques

      • Approach: Focus on functionally validated CpG sites

    • Heterogeneous Sample Types:

      • Solution: Single-cell approaches for resolving cellular heterogeneity

      • Alternative: Microdissection to enrich for specific cell populations

      • Approach: Appropriate statistical methods for heterogeneous data

  • Translational Barriers:

    • Limited Clinical Samples with Complete Annotation:

      • Solution: Establish prospective biobanks with comprehensive data

      • Alternative: Leverage existing cohorts with supplemental analysis

      • Approach: Form collaborative networks to increase sample availability

    • Lack of Gene-Environment Interaction Data:

      • Solution: Collect comprehensive environmental exposure information

      • Alternative: Incorporate exposome analysis in study design

      • Approach: Design studies explicitly addressing these interactions

  • Research Continuation Needs:

    • Further Functional Assays:

      • Solution: Develop assays beyond current expression/methylation studies

      • Alternative: Explore new functional endpoints

      • Approach: Integrate with mechanistic studies of tumor suppression

As noted in published research, additional studies will be required to address limitations such as the lack of gene-to-environment interaction data and the need for further functional assays exploring the mechanisms underlying LRRC3B's effects on cancer development .

How can researchers effectively analyze the conflicting data regarding LRRC3B's role across different cancer types?

Analyzing conflicting data regarding LRRC3B requires a systematic, multi-faceted approach:

  • Meta-analytical Framework:

    • Aggregate Data Assessment:

      • Systematically compile results across studies with standardized effect measures

      • Apply forest plots to visualize consistency/heterogeneity

      • Calculate I² statistics to quantify between-study variation

      • Use funnel plots to assess publication bias

    • Subgroup Analysis:

      • Stratify by cancer type, ethnicity, and methodological approaches

      • Consider age-specific effects (as seen with rs1907168 in patients ≤51 years)

      • Examine tissue-specific expression patterns across cancer types

  • Contextual Factors Evaluation:

    • Tumor Microenvironment Context:

      • Compare LRRC3B function in immune-hot versus immune-cold tumors

      • Assess cancer types with different baseline immune infiltration profiles

      • Evaluate LRRC3B in relation to immunomodulatory gene signatures

    • Molecular Subtype Context:

      • Analyze LRRC3B's role across molecular subtypes within cancer types

      • Consider receptor status in breast cancer (associations with PR status)

      • Examine proliferation markers like Ki67 that showed associations with LRRC3B

  • Technical Variation Assessment:

    • Methodological Differences:

      • Compare results from different methylation analysis platforms

      • Evaluate array-based versus sequencing-based approaches

      • Consider differences in statistical methods and threshold definitions

    • Expression Quantification:

      • Compare RNA-seq, microarray, qPCR, and protein-level data

      • Assess correlation between mRNA and protein expression

      • Consider splice variants and isoform-specific functions

  • Integrated Multi-omics Approach:

    • Cross-platform Validation:

      • Correlate findings from independent datasets (TCGA, GEO, ArrayExpress)

      • Apply multi-omics integration methods to identify consistent patterns

      • Use dimensionality reduction to visualize complex relationships

    • Network-based Analysis:

      • Position LRRC3B in context-specific gene regulatory networks

      • Identify differential network wiring across cancer types

      • Apply causal inference methods to distinguish direct from indirect effects

  • Consensus Development:

    • Evidence Quality Assessment:

      • Apply GRADE framework to evaluate evidence quality

      • Consider sample size, methodological rigor, and replication status

      • Develop consensus statements about well-established versus preliminary findings

    • Mechanistic Reconciliation:

      • Propose unified mechanistic models explaining apparent contradictions

      • Consider tissue-specific cofactors that may modify LRRC3B function

      • Develop testable hypotheses to resolve conflicting observations

This framework provides a comprehensive approach to reconciling seemingly conflicting data about LRRC3B across cancer types, ultimately advancing understanding of its context-dependent functions.

What emerging technologies might advance our understanding of LRRC3B biology?

Several cutting-edge technologies are poised to transform LRRC3B research:

  • Advanced Genomic Engineering:

    • Base Editing and Prime Editing:

      • Precise introduction of LRRC3B polymorphisms without double-strand breaks

      • Creation of isogenic cell lines differing only in specific LRRC3B variants

      • Functional validation of SNPs like rs1907168 and rs78205284

    • Epigenome Editing:

      • Targeted modification of LRRC3B promoter methylation using dCas9-DNMT/TET systems

      • Site-specific histone modification modulation

      • Reversible control of LRRC3B expression to study temporal effects

  • Single-Cell Multi-omics:

    • Integrated Single-Cell Analysis:

      • Simultaneous measurement of DNA, RNA, protein, and epigenetic states

      • Spatial resolution of LRRC3B expression in tumor microenvironments

      • Trajectory analysis of cells transitioning through different LRRC3B states

    • Spatial Transcriptomics/Proteomics:

      • Mapping LRRC3B expression in spatial context with immune cells

      • Visualizing microenvironmental niches with different LRRC3B status

      • Co-expression analysis with immune checkpoint molecules

  • Advanced Protein Analysis:

    • Cryo-EM and AlphaFold-Based Modeling:

      • High-resolution structural determination of LRRC3B

      • Mapping of functional domains and interaction interfaces

      • Structure-guided drug design targeting LRRC3B or its regulators

    • Proteome-wide Interaction Mapping:

      • Application of proximity labeling methods in context-specific manner

      • Thermal proteome profiling to identify LRRC3B-dependent complexes

      • Protein correlation profiling across subcellular compartments

  • Advanced Computational Approaches:

    • Deep Learning Applications:

      • Prediction of LRRC3B-regulated enhancers and target genes

      • Integration of multi-omics data through neural networks

      • Development of refined methylation-based biomarkers beyond current silencing score

    • Patient-Specific Modeling:

      • Digital twin approaches integrating patient-specific LRRC3B data

      • Personalized prediction of therapy response based on LRRC3B status

      • Virtual clinical trials for LRRC3B-targeting approaches

  • Translational Technologies:

    • Liquid Biopsy for LRRC3B Methylation:

      • Cell-free DNA methylation analysis of LRRC3B promoter

      • Circulating tumor cell analysis for LRRC3B expression

      • Longitudinal monitoring of LRRC3B status during treatment

    • High-Throughput Drug Screening:

      • CRISPR-based screens for synthetic lethality with LRRC3B loss

      • Compound libraries targeting proteins that regulate LRRC3B

      • Patient-derived organoid screening with LRRC3B-modulating compounds

These emerging technologies offer unprecedented opportunities to unravel the complexities of LRRC3B biology and translate findings into clinical applications.

What are the most promising directions for translational research involving LRRC3B?

The most promising translational research directions for LRRC3B include:

  • Precision Oncology Biomarkers:

    • Immunotherapy Response Prediction:

      • Refinement of the LRRC3B methylation-based silencing score for anti-PD-1/PD-L1 therapy selection

      • Development of clinical assays for rapid LRRC3B methylation assessment

      • Prospective validation in diverse immunotherapy cohorts beyond current datasets

    • Risk Stratification Models:

      • Integration of LRRC3B polymorphisms (rs1907168, rs78205284) into genetic risk scores

      • Age-specific risk assessment tools incorporating LRRC3B status

      • Combination with established clinical parameters (PR status, Ki67, tumor size)

  • Therapeutic Development:

    • Epigenetic Modifiers:

      • Development of targeted approaches to reverse LRRC3B promoter methylation

      • Combination strategies with existing DNMT inhibitors to enhance efficacy

      • Identification of upstream regulators of LRRC3B methylation as drug targets

    • Immunomodulatory Approaches:

      • Development of strategies to enhance immune infiltration in LRRC3B-low tumors

      • Targeting immunosuppressive cells enriched in LRRC3B-silenced environments

      • Combination protocols with immunotherapy based on LRRC3B status

  • Early Detection and Screening:

    • Liquid Biopsy Development:

      • LRRC3B methylation in circulating tumor DNA as an early detection marker

      • Multi-marker panels incorporating LRRC3B status

      • Cancer type-specific screening approaches based on LRRC3B signatures

    • Risk Assessment Tools:

      • Integration of LRRC3B polymorphisms into risk prediction models

      • Population screening approaches in high-risk groups

      • Preventive intervention studies stratified by LRRC3B status

  • Clinical Trial Design:

    • Biomarker-Driven Trials:

      • Stratification based on LRRC3B methylation status

      • Adaptive designs incorporating LRRC3B response markers

      • Basket trials across cancer types with similar LRRC3B alterations

    • Combination Strategy Optimization:

      • Rational combinations targeting LRRC3B-related pathways

      • Sequential therapy approaches modulating LRRC3B before immunotherapy

      • Dose-optimization studies based on LRRC3B methylation levels

  • Functional Genomics Applications:

    • Development of Functional Assays:

      • High-throughput screening for modulators of LRRC3B expression

      • Synthetic lethality screens in LRRC3B-deficient backgrounds

      • Drug sensitivity profiling based on LRRC3B status using approaches similar to GDSC analysis

These translational directions build upon the substantial basic science foundation and offer concrete pathways toward clinical impact in cancer diagnosis, prognosis, and treatment.

How might interdisciplinary collaboration accelerate LRRC3B research and clinical applications?

Interdisciplinary collaboration can dramatically accelerate LRRC3B research through strategic integration of diverse expertise:

  • Essential Disciplinary Combinations:

    • Cancer Biology + Immunology:

      • Integrated study of LRRC3B in tumor-immune interactions

      • Development of ex vivo tumor-immune interaction models

      • Translation of findings from immunosuppressive cell enrichment studies

    • Epigenetics + Structural Biology:

      • Elucidation of LRRC3B methylation mechanisms

      • Structure-based design of molecules targeting LRRC3B or its regulators

      • Integration of genetic (SNPs) and epigenetic (methylation) data

    • Bioinformatics + Clinical Oncology:

      • Refinement of prediction models for immunotherapy response

      • Development of clinically applicable LRRC3B silencing scores

      • Implementation of decision support tools based on LRRC3B status

  • Collaborative Infrastructure Requirements:

    • Multi-institutional Biobanks:

      • Coordinated collection of samples with LRRC3B characterization

      • Standardized processing and annotation protocols

      • Integration of diverse population groups to address ethnogeographic variations

    • Shared Data Platforms:

      • Cloud-based repositories for LRRC3B multi-omics data

      • Harmonized analytical pipelines for consistent processing

      • Interactive visualization tools for complex methylation-expression relationships

    • Collaborative Computational Resources:

      • Distributed computing for complex modeling tasks

      • Standardized implementation of silencing score algorithms

      • Integration with other cancer genomic resources

  • Novel Collaborative Methodologies:

    • Team Science Approaches:

      • Formation of integrated research teams with complementary expertise

      • Development of common vocabulary across disciplines

      • Creation of translational research roadmaps with defined handoff points

    • Open Science Initiatives:

      • Pre-registration of LRRC3B research protocols

      • Data sharing at intermediate research stages

      • Collaborative tool development for LRRC3B analysis

    • Industry-Academia Partnerships:

      • Co-development of LRRC3B-based diagnostics

      • Collaborative clinical trials incorporating LRRC3B biomarkers

      • Shared platforms for therapeutic development

  • Translational Acceleration Strategies:

    • Regulatory Science Integration:

      • Early engagement with regulatory agencies on LRRC3B biomarkers

      • Development of standards for methylation-based diagnostics

      • Creation of reference materials for assay validation

    • Clinical Implementation Pathways:

      • Involvement of healthcare economics experts for cost-effectiveness analysis

      • Engagement with pathology networks for standardized testing

      • Development of clear clinical guidelines for LRRC3B testing

These collaborative approaches can address the complex challenges identified in current research, such as the need for functional assays and gene-environment interaction data that cannot be fully explored within single disciplinary frameworks .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.