Recombinant Human Leucine-rich repeat-containing protein 3 (LRRC3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize development accordingly.
Synonyms
LRRC3; C21orf102; LRRC3A; UNQ9233/PRO31982; Leucine-rich repeat-containing protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
33-257
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
LRRC3
Target Protein Sequence
CPQPCRCPDHAGAVAVFCSLRGLQEVPEDIPANTVLLKLDANKISHLPDGAFQHLHRLRE LDLSHNAIEAIGSATFAGLAGGLRLLDLSYNRIQRIPKDALGKLSAKIRLSHNPLHCECA LQEALWELKLDPDSVDEIACHTSVQEEFVGKPLVQALDAGASLCSVPHRTTDVAMLVTMF GWFAMVIAYVVYYVRHNQEDARRHLEYLKSLPSAPASKDPIGPGP
Uniprot No.

Target Background

Gene References Into Functions
  1. Promoter reporter assays in HEK 293 cells indicate that the C21orf30 distal promoter contains an activating cis-regulatory element responsive to serum depletion. PMID: 20494980
Database Links

HGNC: 14965

OMIM: 617620

KEGG: hsa:81543

STRING: 9606.ENSP00000291592

UniGene: Hs.326579

Protein Families
LRRC3 family
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Widely expressed; detected in testis, lung, small intestine, breast, brain, heart, bone marrow, placenta, colon, fetal brain, liver, fetal liver, thymus, salivary gland, spinal cord, spleen, trachea and adrenal gland.

Q&A

Many LRR proteins undergo significant post-translational modifications that regulate their function. LRRTM3 contains N-linked glycosylation sites in its extracellular region, while the cytoplasmic region contains potential phosphorylation sites (tyrosine, serine, and threonine residues) that may be involved in signal transduction . Similarly, FLRT3 is described as a glycoprotein .

To characterize post-translational modifications of LRRC3, researchers should:

  • Use prediction algorithms to identify potential modification sites

  • Employ mass spectrometry to map actual modifications

  • Create site-directed mutants to assess functional significance

  • Compare modifications across different cell types and developmental stages

  • Investigate enzymatic pathways responsible for these modifications

Glycosylation is particularly important to evaluate, as it may affect protein folding, stability, and ligand recognition properties.

What expression systems are optimal for producing recombinant human LRRC3?

Based on successful production methods for other LRR proteins, researchers should consider the following approaches:

LRR ProteinExpression RegionTag UsedFormulationReconstitutionStorage RecommendationsFunctional Assay
LRRTM3Glu31-Lys419C-terminal 6-HisLyophilized from PBS100 μg/mL in sterile PBSAvoid freeze-thaw cyclesNeurite outgrowth of rat embryonic cortical neurons
FLRT3Lys29-Pro528C-terminal 6-HisLyophilized from PBS200 μg/mL in sterile PBSAvoid freeze-thaw cyclesPromotes neurite outgrowth

For recombinant LRRC3 production, mammalian expression systems are likely optimal, particularly for ensuring proper folding and post-translational modifications. HEK293 or CHO cells are recommended over bacterial systems, especially if the protein contains disulfide bonds or requires glycosylation. The extracellular domain (ECD) may be easier to express than the full-length protein with transmembrane regions.

Expression constructs should include:

  • A signal peptide for secretion

  • The LRRC3 sequence (full-length or ECD)

  • An affinity tag (6-His or Fc) for purification

  • Optional protease cleavage sites to remove tags after purification

Baculovirus-insect cell systems represent a good alternative for larger-scale production if mammalian systems yield insufficient protein.

What purification and storage protocols are recommended for recombinant LRRC3?

Drawing from protocols used for similar proteins, recombinant LRRC3 purification should include:

  • Initial capture using affinity chromatography (Ni-NTA for His-tagged proteins)

  • Intermediate purification via ion exchange chromatography to remove contaminants

  • Final polishing using size exclusion chromatography to ensure monodispersity

  • Buffer optimization to maintain stability (typically PBS with possible additives)

For storage, researchers should:

  • Determine protein stability at different temperatures (4°C, -20°C, -80°C)

  • Evaluate freeze-thaw stability; lyophilization may be beneficial as used for LRRTM3 and FLRT3

  • Consider carrier-free formulations for applications where BSA might interfere

  • Use a manual defrost freezer and avoid repeated freeze-thaw cycles

  • Evaluate stabilizing additives such as glycerol, sucrose, or specific salts

Quality control should include SDS-PAGE, Western blotting, mass spectrometry, and functional assays to verify identity, purity, and activity before and after storage.

What functional assays can validate recombinant LRRC3 activity?

Based on assays developed for related LRR proteins, several approaches may validate LRRC3 activity:

  • Binding assays: Surface plasmon resonance or bio-layer interferometry to measure binding to predicted interaction partners.

  • Cell-based assays: LRRTM3's activity is measured by its ability to enhance neurite outgrowth of rat embryonic cortical neurons . Similarly, FLRT3 promotes neurite outgrowth and is involved in cell adhesion .

  • Phosphorylation analysis: If LRRC3 affects signaling pathways, phosphorylation of downstream targets can be measured by phospho-specific antibodies.

  • Protein-protein interaction: Co-immunoprecipitation experiments to confirm interaction with binding partners identified through screening approaches.

  • Reporter assays: If LRRC3 influences gene transcription through signaling pathways, luciferase-based reporter systems can measure this effect.

Researchers should develop multiple orthogonal assays to robustly characterize LRRC3 function, as reliance on a single assay may lead to incomplete understanding of the protein's activities.

What approaches can identify potential binding partners of LRRC3?

Identifying binding partners is crucial for understanding LRRC3 function. Several complementary methodologies should be employed:

  • Affinity chromatography coupled with mass spectrometry: This approach successfully identified latrophilin 3 as a binding partner for FLRT3 . Recombinant LRRC3 extracellular domain could be immobilized and used to capture binding partners from tissue lysates.

  • Proximity labeling: BioID or APEX2 fusions with LRRC3 expressed in relevant cell types can identify proteins in close proximity in living cells, capturing both stable and transient interactions.

  • Yeast two-hybrid screening: This approach was successfully used to identify PSD-95 as an interactor of NGL proteins (structurally related to LRRTMs) . It's particularly useful for identifying interactions mediated by cytoplasmic domains.

  • Co-immunoprecipitation: Traditional pull-down experiments with tagged LRRC3 can validate interactions identified through screening approaches.

  • Surface plasmon resonance or bio-layer interferometry: These methods provide quantitative binding parameters (affinity, kinetics) for interactions with candidate partners.

  • Cross-linking mass spectrometry: This can identify specific binding interfaces between LRRC3 and its partners.

Data integration across multiple methods is essential for distinguishing true interactors from false positives while building a comprehensive interaction network.

How might LRRC3 function in neural development compared to other LRR proteins?

Several LRR proteins play critical roles in neural development. LRRTM3 is detected in neural progenitors that develop into the rostral neural tube and forebrain , and may be involved in CNS formation and maintenance . FLRT3 promotes neurite outgrowth and is up-regulated following peripheral nerve injury .

To investigate LRRC3's potential role in neural development, researchers should:

  • Characterize spatiotemporal expression: Map LRRC3 expression throughout neural development using in situ hybridization and immunohistochemistry.

  • Perform loss-of-function studies: Use CRISPR/Cas9, shRNA, or antisense morpholinos to reduce LRRC3 expression during development and assess neural phenotypes.

  • Conduct gain-of-function experiments: Overexpress LRRC3 in neural progenitors or neurons to evaluate effects on differentiation, migration, and synaptogenesis.

  • Assess synapse formation: Given that LRRTMs organize excitatory synapses , evaluate LRRC3's potential role in synaptogenesis using electrophysiology and imaging.

  • Investigate pathway integration: Determine how LRRC3 interacts with established neurodevelopmental signaling pathways (e.g., Wnt, Notch, FGF). FLRT proteins regulate FGF signaling during development , suggesting potential parallels for LRRC3.

Comparative studies with better-characterized LRR proteins would provide context for understanding LRRC3's specific functions.

What potential roles might LRRC3 play in disease pathogenesis?

Several LRR proteins have been implicated in disease processes. LRRTM3 has been shown to promote processing of amyloid-precursor protein by BACE1 and is a positional candidate gene for late-onset Alzheimer's disease . Mutations in LRRK2 cause both familial and sporadic Parkinson's disease .

To investigate LRRC3's potential involvement in disease:

  • Genetic association studies: Analyze whether LRRC3 variants are associated with neurological or other disorders through genome-wide association studies or targeted sequencing.

  • Expression analysis in disease tissues: Compare LRRC3 expression between normal and pathological tissues using qRT-PCR, Western blotting, or immunohistochemistry.

  • Functional studies of disease-associated variants: For any identified variants, assess their impact on LRRC3 expression, localization, binding interactions, and downstream signaling.

  • Animal models: Generate knockout or knock-in models to evaluate systemic effects of LRRC3 loss or mutation.

  • Pathway analysis: Investigate whether LRRC3 interacts with known disease-associated proteins or pathways, similar to LRRTM3's interaction with amyloid processing .

Given the roles of other LRR proteins in neurological disorders, particular attention should be paid to potential roles of LRRC3 in neurodevelopmental or neurodegenerative conditions.

How should controls be designed for LRRC3 functional studies?

Robust experimental design requires carefully considered controls:

  • Negative controls:

    • Empty vector controls for overexpression studies

    • Non-targeting shRNA/siRNA for knockdown experiments

    • Isotype-matched antibodies for immunoprecipitation

    • Recombinant protein from the same expression system but unrelated to LRR family

  • Positive controls:

    • Well-characterized LRR proteins (LRRTM3, FLRT3) in parallel experiments

    • Known binding partners or pathways for interaction studies

    • Tissues with validated LRRC3 expression for antibody validation

  • Domain-specific controls:

    • Truncation constructs to map functional domains

    • Point mutants to disrupt specific interactions or functions

    • Chimeric proteins with domains swapped between LRR family members

  • Rescue experiments:

    • Re-expression of wild-type LRRC3 in knockout/knockdown models

    • Expression of orthologous LRRC3 from different species to assess conservation of function

  • Dose-response relationships:

    • Titration of recombinant protein in functional assays

    • Inducible expression systems to evaluate concentration-dependent effects

Such controlled experiments are essential for establishing the specificity and biological relevance of observed LRRC3 functions.

How can contradictory results in LRRC3 functional studies be reconciled?

When facing contradictory results in LRRC3 studies, methodical analysis of experimental differences is crucial:

  • Protein differences:

    • Verify protein identity and integrity by mass spectrometry

    • Compare post-translational modifications across preparations

    • Assess oligomeric state and potential aggregation

    • Evaluate tags and their potential interference with function

  • Experimental conditions:

    • Compare buffer composition, pH, temperature, and ion concentrations

    • Assess cell types used and their endogenous expression of LRRC3 and potential partners

    • Evaluate time points examined (acute vs. chronic effects)

    • Consider the sensitivity and dynamic range of assay readouts

  • Genetic background factors:

    • In cell lines, verify the presence/absence of endogenous LRRC3

    • In animal models, consider strain differences that might influence phenotypes

    • Check for compensatory expression of related LRR proteins

  • Isoform-specific effects:

    • Determine if different studies examined different LRRC3 isoforms

    • Many LRR proteins have multiple isoforms with distinct functions, like LRRTM3 which has two isoforms with different cytoplasmic regions

  • Replication studies:

    • Design experiments that systematically test conditions from conflicting studies

    • Obtain reagents from original laboratories when possible

    • Consider collaborative replication studies across laboratories

Careful documentation and reporting of methodological details will facilitate reconciliation of apparently contradictory findings.

What statistical approaches are recommended for analyzing LRRC3 expression data?

Robust statistical analysis of LRRC3 expression requires:

  • Experimental design considerations:

    • Power analysis to determine appropriate sample sizes

    • Randomization and blinding procedures to minimize bias

    • Technical and biological replicates to account for variability

  • Normalization strategies:

    • Multiple reference genes for qRT-PCR data normalization

    • Appropriate normalization for proteomics data (total protein, housekeeping proteins)

    • Batch effect correction for large datasets

  • Statistical testing:

    • Parametric tests (t-test, ANOVA) when assumptions are met

    • Non-parametric alternatives when data does not follow normal distribution

    • Multiple testing correction (Benjamini-Hochberg, Bonferroni) for genome-wide or proteome-wide analyses

  • Correlation analyses:

    • Co-expression patterns with other LRR family members

    • Correlation with potential binding partners or pathway components

    • Temporal correlations during development or disease progression

  • Data visualization:

    • Box plots showing distribution rather than simple bar graphs

    • Visualization of both effect size and statistical significance

    • Clear representation of sample size and variability

How can functional redundancy among LRR family members be addressed experimentally?

Functional redundancy among related proteins presents a significant challenge in determining protein-specific functions:

  • Comprehensive expression profiling:

    • Determine which LRR family members are co-expressed in tissues of interest

    • Single-cell RNA-seq to identify cell populations with overlapping expression

    • Protein co-localization studies using immunofluorescence or proximity ligation assays

  • Multiple gene perturbation:

    • Combined knockdown/knockout of multiple family members

    • CRISPR/Cas9 multiplexing to target multiple genes simultaneously

    • Inducible systems for temporal control of gene silencing

  • Domain-specific approaches:

    • Identify and target unique domains not shared among family members

    • Create chimeric proteins to isolate domain-specific functions

    • Develop inhibitors or blocking antibodies with demonstrated specificity

  • Rescue experiments:

    • Test whether expression of other family members can compensate for LRRC3 loss

    • Structure-function analysis to identify specific regions required for functional redundancy

  • Systems biology approaches:

    • Network analysis to identify unique and shared interaction partners

    • Pathway enrichment analysis to distinguish specific and redundant functions

    • Mathematical modeling to predict effects of combinatorial perturbations

These approaches can disentangle specific LRRC3 functions from those shared with other LRR family members.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.