Recombinant Human Leucine-rich repeat-containing protein 4C (LRRC4C)

Shipped with Ice Packs
In Stock

Description

Production of Recombinant LRRC4C

Recombinant LRRC4C is produced through various expression systems to facilitate research and potential therapeutic applications. The most common production methods include:

Expression Systems

Recombinant Human LRRC4C can be expressed in several host systems:

Expression SystemAdvantagesCommon Applications
E. coliHigh yield, cost-effectiveStructural studies, antibody production
Mammalian cellsProper folding, post-translational modificationsFunctional studies, interaction analyses
BaculovirusHigher expression levels, eukaryotic processingComplex protein expression
Cell-free expressionRapid production, avoids cell toxicityPreliminary screening studies

Synapse Formation and Neuronal Development

LRRC4C functions as a critical regulator of synapse formation and neuronal development through several mechanisms:

  1. It serves as a specific binding partner for netrin G1 (NTNG1), a member of the netrin family of axon guidance molecules

  2. Promotes neurite outgrowth of developing thalamic neurons

  3. Acts as a key factor for regulating synapse formation, stability, and excitatory transmission

  4. Functions as a member of the partitioning-defective protein (PAR) polarity complex that promotes axon differentiation

Research using knockout models demonstrates that LRRC4C deletion moderately suppresses excitatory synapse development and function in the hippocampus . Importantly, while LRRC4C is mainly detected in the stratum lacunosum moleculare (SLM) layer of the hippocampus, its deletion leads to decreases in postsynaptic densities in both SLM and stratum radiatum (SR) layers, particularly in the ventral hippocampus .

Hippocampal Function and Memory Processing

LRRC4C plays a crucial role in hippocampal information processing:

  1. Regulates the indirect channel of information input to the hippocampus by mediating the formation of Schaffer collateral synapses

  2. Influences short-term synaptic plasticity in both SLM and SR excitatory synapses

  3. Contributes to memory formation and storage through its effects on synaptic connections

The hippocampus receives sensory and spatial information through direct and indirect channels. The entorhinal cortex connects directly to the stratum lacunosum-moleculare (SLM) in the CA1 area, forming the direct channel. The indirect channel involves connections from the entorhinal cortex to the dentate gyrus, then to CA3, and finally to the stratum radiatum (SR) in CA1 through Schaffer collateral axons .

LRRC4C is predominantly restricted to the SLM in the CA1 area, while its family member LRRC4 (NGL-2) is restricted to SR. Deletion of LRRC4C affects the formation of synapses and impacts information processing in the hippocampus, thereby influencing memory formation and storage .

![LRRC4C in Hippocampal Information Pathways](https://journals.lww.com/cmj/fulltext/2023/01050/leucine_rich_repeats_containing_4_protein_ological Implications

LRRC4C in Autism Spectrum Disorder

Multiple lines of evidence implicate LRRC4C in autism spectrum disorder (ASD):

  1. LRRC4C has been identified as a candidate susceptibility gene for autism

  2. De novo missense variants in LRRC4C have been found in ASD probands from the Autism Sequencing Consortium

  3. Three de novo missense variants, including one predicted to be probably damaging, were identified in ASD cases

  4. A protein-truncating variant was observed in a case sample from the Danish iPSYCH study

  5. TADA analysis identified LRRC4C as a candidate gene with a false discovery rate between 0.05 and 0.1

These findings suggest that disruptions in LRRC4C function may contribute to the synaptic abnormalities that are frequently observed in autism spectrum disorders.

LRRC4C in Cancer

LRRC4C has been implicated in several cancer types:

Colon and Gastric Cancers

Studies have shown that LRRC4C expression in the tumor microenvironment (TME) positively correlates with colon cancer progression . Analysis of transcriptome RNA-seq data from 446 patients with colon cancer and 585 additional samples revealed:

  1. LRRC4C expression correlates positively with clinicopathological characteristics and negatively with patient survival in colon adenocarcinoma (COAD)

  2. High levels of LRRC4C expression are associated with poor prognosis in both colon and gastric cancers

  3. Gene set enrichment analysis indicated that high LRRC4C expression groups were mainly enriched in immune-related activities

Glioblastoma

LRRC4C's family member LRRC4 has been identified as a suppressor gene for gliomas and is involved in gliomagenesis . LRRC4 functions as:

  1. A novel inhibitor of autophagy in glioblastoma (GB)

  2. An enhancer of sensitivity to temozolomide (TMZ), the first-line drug for patients with GB

  3. An inhibitor of protein-protein interactions in GB through its PDZ-binding domain

While these findings primarily relate to LRRC4 rather than LRRC4C, they suggest potential shared mechanisms within this protein family.

LRRC4C in Neurological Conditions

LRRC4C has been identified as a neuroprotective factor in spinal nerve damage . Studies have shown that in LRRC4 knockdown mice, the expression levels of autophagy markers Beclin-1 and microtubule-associated protein 1 light chain 3B (LC3B) in brain and spinal cord tissues were significantly higher than in wild-type mice .

Research Applications and Future Perspectives

Recombinant LRRC4C has multiple applications in neuroscience research:

  1. Investigation of synapse formation and function

  2. Studies of neural development and axon guidance

  3. Research into autism spectrum disorders and potential therapeutic targets

  4. Cancer research, particularly in understanding tumor microenvironments

Future research directions may include:

  1. Development of targeted therapies for conditions associated with LRRC4C dysfunction

  2. Further characterization of LRRC4C's role in different brain regions and neuronal circuits

  3. Investigation of potential biomarker applications in autism and cancer diagnostics

  4. Exploration of LRRC4C modulation as a therapeutic strategy in neurological conditions

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
LRRC4C; KIAA1580; NGL1; UNQ292/PRO331; Leucine-rich repeat-containing protein 4C; Netrin-G1 ligand; NGL-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
45-640
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
LRRC4C
Target Protein Sequence
QTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEI LQLSRNHIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIP SYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIKLDEL DLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPH DLFTPLHHLERIHLHHNPWNCNCDILWLSWWIKDMAPSNTACCARCNTPPNLKGRYIGEL DQNYFTCYAPVIVEPPADLNVTEGMAAELKCRASTSLTSVSWITPNGTVMTHGAYKVRIA VLSDGTLNFTNVTVQDTGMYTCMVSNSVGNTTASATLNVTAATTTPFSYFSTVTVETMEP SQDEARTTDNNVGPTPVVDWETTNVTTSLTPQSTRSTEKTFTIPVTDINSGIPGIDEVMK TTKIIIGCFVAITLMAAVMLVIFYKMRKQHHRQNHHAPTRTVEIINVDDEITGDTPMESH LPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI
Uniprot No.

Target Background

Function
May promote neurite outgrowth in developing thalamic neurons.
Gene References Into Functions
  1. This study suggests that the proband's autism may result from disruptions in both DPP6 and LRRC4C, highlighting the potential importance of netrin G family and potassium channel interacting molecules in neurodevelopmental disorders. PMID: 27759917
  2. The tripartite NGL-1, netrin-G1, and LAR adhesion complex interaction promotes excitatory synapse development. PMID: 23986473
  3. Netrin-G1 is a key component of the NGL-1 receptor, promoting thalamocortical axon (TCA) outgrowth. Membrane-bound netrins participate in receiving axonal signaling pathways. PMID: 14595443
  4. NGL-1 is most abundant in the striatum and cerebral cortex—the intermediate and final targets of thalamocortical axons. Membrane-bound NGL-1 stimulates, while soluble NGL-1 disrupts, the growth of embryonic thalamic axons. PMID: 14595443
Database Links

HGNC: 29317

OMIM: 608817

KEGG: hsa:57689

STRING: 9606.ENSP00000278198

UniGene: Hs.745123

Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Highly expressed in the cerebral cortex, including frontal, parietal and occipital lobes. Putamen, amygdala, hippocampus and medulla oblongata show moderate expression. Caudate nucleus and thalamus express small amounts, whereas other brain regions show v

Q&A

What is the molecular identity of LRRC4C and its primary neurobiological role?

LRRC4C encodes Netrin-G ligand-1 (NGL-1), a post-synaptic adhesion molecule implicated in various brain disorders, including bipolar disorder, autism spectrum disorder, and developmental delay . As a key synaptic protein, NGL-1 plays crucial roles in synapse development and function, particularly in regulating neuronal excitability across multiple brain regions. Studies have demonstrated its importance for normal locomotor activity, anxiety-like behavior, and specific forms of learning and memory .

How does the domain structure of LRRC4C relate to its function?

LRRC4C contains multiple leucine-rich repeat domains that facilitate protein-protein interactions, particularly with its presynaptic binding partner netrin-G1. The protein's structural arrangement enables it to form trans-synaptic complexes that contribute to synaptic specificity and organization. This structural arrangement allows LRRC4C to interact with postsynaptic scaffolding proteins via its C-terminal region, forming a molecular bridge that regulates excitatory synaptic transmission in key brain circuits .

What phenotypes are observed in LRRC4C knockout models?

Mice lacking NGL-1 (Lrrc4c–/–) display distinct behavioral phenotypes, including strong hyperactivity in familiar environments, anxiolytic-like behavior in multiple testing paradigms, and impaired spatial and working memory . Interestingly, these mice maintain normal object-recognition memory and social interaction despite LRRC4C's association with autism spectrum disorder. The behavioral profile suggests LRRC4C plays specialized roles in specific neural circuits rather than having global effects on all behaviors .

What expression systems are optimal for recombinant LRRC4C production?

For high-quality recombinant LRRC4C production, researchers typically employ mammalian expression systems (HEK293 or CHO cells) to ensure proper protein folding and post-translational modifications . Various tagging options are available, including GST and rho-1D4 tags, with the latter being particularly useful for purification and detection purposes . When designing expression constructs, researchers should consider tag placement carefully to avoid interfering with LRRC4C's functional domains, particularly the leucine-rich repeat regions that mediate protein interactions.

How can researchers effectively measure neuronal activity changes in LRRC4C-deficient models?

c-Fos immunostaining provides a powerful approach for assessing neuronal activity alterations in LRRC4C-deficient models. Studies have revealed that Lrrc4c–/– mice exhibit substantially decreased c-fos signals under both baseline conditions and during anxiety-inducing stimuli across multiple brain regions, including the anterior cingulate cortex (ACC), motor cortex (MO), endopiriform nucleus (EPd), and hippocampus . This technique can be complemented with electrophysiological recordings to directly measure changes in synaptic transmission and neuronal excitability in specific brain regions of interest.

What behavioral assays are most informative for characterizing LRRC4C functions?

A comprehensive behavioral assessment battery should include:

  • Laboras cages for monitoring activity in familiar environments

  • Open field tests for assessing activity in novel environments

  • Elevated plus maze and light-dark box tests for anxiety-like behaviors

  • Forced swim tests for depression-like behaviors

  • Three-chamber tests for social approach and interaction

  • Spatial and working memory tasks

These assays have revealed that Lrrc4c–/– mice exhibit strong hyperactivity in familiar environments, anxiolytic-like behavior, and specific memory deficits, providing a behavioral signature of LRRC4C function .

What is the evidence linking LRRC4C to autism spectrum disorder?

LRRC4C/LRRC4C has been genetically linked to autism spectrum disorder through multiple studies . The NGL-1-interacting proteins netrin-G1 and CDKL5 have also been associated with ASD, suggesting involvement in a common molecular pathway . Despite this genetic association, Lrrc4c–/– mice display normal social interaction in three-chamber tests, indicating that LRRC4C's contribution to ASD may involve other aspects of the disorder beyond social deficits, possibly including the hyperactivity phenotype observed in these mice .

How does LRRC4C modulate anxiety-related neural circuits?

Lrrc4c–/– mice display pronounced anxiolytic-like behavior in multiple behavioral paradigms, including the elevated plus maze and light-dark box tests . c-Fos mapping reveals that these mice have altered neuronal activity in key anxiety-related brain regions, including the anterior cingulate cortex, bed nuclei of the stria terminalis, and lateral septum . Notably, while wild-type mice show increased c-fos expression upon exposure to anxiety-inducing conditions, this response is substantially blunted in Lrrc4c–/– mice, suggesting LRRC4C regulates neuronal activation in anxiety-processing circuits .

What cellular mechanisms underlie LRRC4C's role in learning and memory?

LRRC4C influences specific types of learning and memory through its effects on synaptic transmission and neuronal excitability in memory-related brain regions. Lrrc4c–/– mice show impaired spatial and working memory and delayed learning of visual discrimination . Altered c-fos expression in hippocampal regions (dentate gyrus, CA3, CA1) suggests disrupted neuronal activation patterns during memory formation and retrieval . These findings indicate LRRC4C plays a critical role in regulating the excitability and synaptic properties of neurons involved in specific memory processes.

How do protein-protein interactions mediate LRRC4C function at synapses?

LRRC4C forms critical interactions with both presynaptic and postsynaptic proteins. Its leucine-rich repeat domains interact with presynaptic netrin-G1 to form trans-synaptic complexes that contribute to synaptic specificity. At the postsynaptic level, LRRC4C interacts with scaffolding proteins through its C-terminal domain . These interactions collectively regulate synapse development, stability, and function. Advanced techniques to study these interactions include co-immunoprecipitation, proximity ligation assays, and structural studies using X-ray crystallography or cryo-electron microscopy.

What role does LRRC4C play in region-specific neuronal excitability?

c-Fos expression analysis in Lrrc4c–/– mice has revealed differential changes in neuronal activity across brain regions . Under baseline conditions, decreased c-fos signals were observed in multiple cortical and subcortical regions, including the anterior cingulate cortex, motor cortex, and hippocampus, while a few regions showed increased activity . This regional specificity suggests LRRC4C differentially regulates neuronal excitability across brain circuits, potentially through region-specific protein interactions or expression levels.

How can post-translational modifications of LRRC4C be studied?

While specific post-translational modifications of LRRC4C are not well characterized, studies of related leucine-rich repeat proteins provide methodological insights. For instance, in the related LRRK proteins, phosphorylation by PKC at specific residues (S1074, T1075) regulates protein function . Similar regulatory mechanisms may exist for LRRC4C. Approaches to study potential modifications include:

  • Mass spectrometry-based proteomics to identify modification sites

  • Phospho-specific antibodies for Western blotting and immunostaining

  • Site-directed mutagenesis to assess functional significance

  • Differential scanning fluorimetry to determine effects on protein stability

What are the molecular mechanisms underlying reduced neuronal activity in LRRC4C-deficient models?

The widespread reduction in c-fos expression across multiple brain regions in Lrrc4c–/– mice suggests fundamental alterations in neuronal excitability . Electrophysiological studies could determine whether these changes result from:

  • Altered synaptic transmission (excitatory/inhibitory balance)

  • Changes in intrinsic neuronal excitability

  • Circuit-level reorganization

  • Compensatory adaptations to LRRC4C loss

Understanding these mechanisms would provide insights into how LRRC4C regulates neuronal activity and how its dysfunction contributes to neuropsychiatric disorders.

What are the key behavioral and neurobiological phenotypes in LRRC4C-deficient models?

Table 1: Behavioral and Neurobiological Phenotypes in Lrrc4c–/– Mice

DomainPhenotypeBrain Regions AffectedSignificance
Locomotor ActivityStrong hyperactivity in familiar environments; Moderate hyperactivity in novel dark environmentsMotor cortex (MO), Anterior cingulate cortex (ACC)Indicates role in motor control circuits
Anxiety-like BehaviorAnxiolytic-like behavior in elevated plus maze and light-dark box testsBed nuclei of the stria terminalis (BNST), Lateral septum (LS), Anterior cingulate cortex (ACC)Reveals involvement in anxiety regulation
Learning & MemoryImpaired spatial and working memory; Normal object-recognition memory; Delayed learning of visual discriminationHippocampus (dentate gyrus, CA1, CA3), Retrosplenial areaEssential for specific memory processes
Social BehaviorNormal social approach and interactionNot specifically alteredNot critical for social interaction despite ASD association
Neuronal ActivitySuppressed baseline activity; Blunted response to anxiety-inducing stimuliWidespread reductions across cortical and subcortical regionsFundamental role in regulating neuronal excitability

What techniques are most effective for studying LRRC4C?

Table 2: Research Techniques for LRRC4C/NGL-1 Investigation

TechniqueApplicationAdvantagesConsiderations
Recombinant Protein ExpressionProduction of LRRC4C with tags (GST, rho-1D4)Allows protein purification for biochemical studiesMammalian expression systems preferred for proper folding
Knockout Mouse ModelsIn vivo functional studiesReveals physiological roles and behavioral impactsLrrc4c–/– mice show distinct behavioral phenotypes
c-Fos ImmunostainingNeuronal activity measurementMaps activity across multiple brain regionsReveals suppressed activity in Lrrc4c–/– mice
ElectrophysiologyMeasuring synaptic transmissionDirect measurement of neuronal functionCan identify specific synaptic alterations in key brain regions
Behavioral AssaysFunctional assessmentProvides behavioral readouts relevant to neuropsychiatric disordersMultiple assays needed for comprehensive characterization
Protein Interaction StudiesIdentifying binding partnersReveals molecular interaction networksEssential for understanding LRRC4C's synaptic functions
Differential Scanning FluorimetryProtein stability assessmentMeasures impact of mutations on protein foldingUseful for studying effects of mutations on protein stability

How does neuronal activity change in response to LRRC4C deficiency?

Under baseline conditions, c-fos signals in Lrrc4c–/– brains are substantially decreased relative to wild-type mice in multiple cortical and subcortical regions . These include the anterior cingulate cortex, motor cortex, piriform cortex, endopiriform nucleus, retrosplenial area, primary somatosensory area, paraventricular nucleus of the thalamus, and dorsal regions of the hippocampus . When exposed to anxiety-inducing stimuli (elevated plus maze), wild-type mice show increased c-fos expression, while this response is significantly blunted in Lrrc4c–/– mice . These findings demonstrate that LRRC4C plays a critical role in regulating both baseline neuronal activity and stimulus-induced neuronal activation across multiple brain regions.

How can circuit-specific functions of LRRC4C be dissected?

Future research should employ circuit-specific approaches to understand LRRC4C's role in different neural pathways. This could include:

  • Cell-type-specific conditional knockout models

  • Circuit-specific optogenetic or chemogenetic manipulations

  • In vivo calcium imaging during behavioral tasks

  • Single-cell transcriptomics to identify co-expression patterns

These approaches would help determine how LRRC4C differentially regulates distinct neural circuits to influence specific behaviors .

What is the translational potential of LRRC4C research for neuropsychiatric disorders?

Given LRRC4C's association with multiple neuropsychiatric disorders, future research should focus on:

  • Human genetic studies to identify disease-associated variants

  • Functional characterization of these variants in cellular and animal models

  • Development of tools to modulate LRRC4C function or expression

  • Exploration of LRRC4C as a potential therapeutic target

Understanding LRRC4C's role in neuropsychiatric disorders could lead to novel diagnostic and therapeutic approaches for conditions including autism spectrum disorder, bipolar disorder, and anxiety disorders .

How does LRRC4C interact with other synaptic proteins to regulate neural circuits?

Further investigation is needed to understand LRRC4C's place within the broader synaptic protein network. Key questions include:

  • How does LRRC4C interact with other adhesion molecules?

  • What signaling pathways are regulated by LRRC4C?

  • How do LRRC4C interactions differ across brain regions?

  • How do developmental changes in LRRC4C expression affect circuit formation?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.