Recombinant Human Leucine-rich repeat-containing protein 70 (LRRC70)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
LRRC70; UNQ1891/PRO4337; Leucine-rich repeat-containing protein 70; Synleurin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
32-622
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
LRRC70
Target Protein Sequence
CSSVCQLCTGRQINCRNLGLSSIPKNFPESTVFLYLTGNNISYINESELTGLHSLVALYL DNSNILYVYPKAFVQLRHLYFLFLNNNFIKRLDPGIFKGLLNLRNLYLQYNQVSFVPRGV FNDLVSVQYLNLQRNRLTVLGSGTFVGMVALRILDLSNNNILRISESGFQHLENLACLYL GSNNLTKVPSNAFEVLKSLRRLSLSHNPIEAIQPFAFKGLANLEYLLLKNSRIRNVTRDG FSGINNLKHLILSHNDLENLNSDTFSLLKNLIYLKLDRNRIISIDNDTFENMGASLKILN LSFNNLTALHPRVLKPLSSLIHLQANSNPWECNCKLLGLRDWLASSAITLNIYCQNPPSM RGRALRYINITNCVTSSINVSRAWAVVKSPHIHHKTTALMMAWHKVTTNGSPLENTETEN ITFWERIPTSPAGRFFQENAFGNPLETTAVLPVQIQLTTSVTLNLEKNSALPNDAASMSG KTSLICTQEVEKLNEAFDILLAFFILACVLIIFLIYKVVQFKQKLKASENSRENRLEYYS FYQSARYNVTASICNTSPNSLESPGLEQIRLHKQIVPENEAQVILFEHSAL
Uniprot No.

Target Background

Function

Renders cells highly sensitive to activation by cytokines and lipopolysaccharide (LPS).

Gene References Into Functions
  1. Synleurin, a novel leucine-rich repeat protein that enhances the intensity of pleiotropic cytokine and growth factor responses. PMID: 12767927
Database Links

HGNC: 35155

KEGG: hsa:100130733

STRING: 9606.ENSP00000399441

UniGene: Hs.721348

Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Expressed at low levels in many tissues, including smooth muscle, brain, uterus, pancreas, cartilage, adipose, spleen and testis.

Q&A

What is Leucine-rich repeat-containing protein 70 (LRRC70)?

Leucine-rich repeat-containing protein 70 (LRRC70) belongs to the large superfamily of leucine-rich repeat (LRR) proteins, which are characterized by structural motifs containing sequence patterns rich in leucine residues. The LRR domains typically form arc-shaped structures with a concave surface lined with beta-sheets and a convex surface with helical elements. This structural arrangement creates an ideal platform for protein-protein interactions, which is the primary function of most LRR-containing proteins. The LRR motif typically follows a consensus sequence pattern of LxxLxLxxN/CxL, where L represents leucine, N is asparagine, C is cysteine, and x can be any amino acid.

LRRC70 contains multiple leucine-rich repeat domains that likely mediate specific protein-protein interactions in cellular signaling pathways. While less extensively characterized than some LRR family members, LRRC70 shares structural similarities with other LRR proteins that function in diverse cellular processes including signal transduction, immune response, and neural development. The protein lacks kinase domains present in the related LRRK proteins (LRRK1/LRRK2), suggesting it may serve primarily as a scaffold or adaptor protein in signaling complexes rather than having enzymatic activity .

Research on related LRR proteins indicates that these proteins often undergo conformational changes upon binding to their partners, suggesting LRRC70 may similarly adopt different conformations during its functional cycle. Understanding the precise biological functions of LRRC70 requires comprehensive biochemical and cellular characterization, as its specific roles may vary depending on cell type, developmental stage, and physiological conditions.

What is the structure and domain organization of LRRC70?

The complete three-dimensional structure of human LRRC70 has not been fully resolved, but domain organization can be predicted based on sequence analysis and comparison with related LRR proteins. LRRC70 is primarily characterized by its leucine-rich repeat domains, which form the core functional units of the protein. Each LRR typically consists of 20-30 amino acids forming a β-strand-turn-α-helix structure, with multiple repeats arranged in tandem to create the characteristic horseshoe-shaped architecture.

Based on analysis of related LRR proteins, the domain organization of LRRC70 likely includes:

  • N-terminal region: May contain regulatory elements or additional functional domains

  • LRR domains: Multiple leucine-rich repeats arranged in tandem (likely 10-20 repeats)

  • LRR capping domains: Special LRR units at the N- and C-terminal ends that shield the hydrophobic core

  • C-terminal region: May contain additional protein interaction motifs or regulatory elements

The open reading frame of LRRC70 in related species spans approximately 1893 base pairs, suggesting a protein of around 630 amino acids . This size is consistent with a multi-domain LRR protein. Unlike the related LRRK proteins, LRRC70 does not contain kinase domains or GTPase domains, focusing its function on protein-protein interactions rather than enzymatic activities.

DomainPredicted LocationPrimary FunctionStructural Features
N-terminal regionFirst ~50-100 aaRegulation, traffickingVariable among LRR proteins
LRR domainsMiddle regionProtein-protein interactionsβ-strand-turn-α-helix repeats
LRR capping domainsFlanking LRR regionStructural stabilizationModified LRR structures
C-terminal regionLast ~50-100 aaRegulation, localizationVariable among LRR proteins

Understanding the precise domain boundaries and structural features requires experimental determination through techniques like X-ray crystallography or cryo-electron microscopy, which have been successfully applied to related LRR proteins .

How does LRRC70 relate to other leucine-rich repeat proteins?

LRRC70 belongs to the expansive superfamily of leucine-rich repeat-containing proteins, which includes over 500 members in humans with diverse functions. Within this superfamily, LRRC70 shares structural similarities with several well-characterized proteins but has distinct features that likely define its specific functions.

The most closely related and well-studied proteins include the leucine-rich repeat kinases (LRRKs), particularly LRRK1 and LRRK2. These large multi-domain proteins combine leucine-rich repeats with functional kinase domains, allowing them to serve as signaling hubs in cells . Unlike LRRKs, LRRC70 lacks kinase domains, suggesting a non-enzymatic role in signaling pathways. The LRR domains in proteins like LRRK1 have been shown to mediate specific protein-protein interactions and regulate protein function through conformational changes .

From an evolutionary perspective, LRRC70 is conserved across mammalian species, with homologs identified in organisms like Propithecus coquereli (Coquerel's sifaka) . This conservation suggests important functional roles that have been maintained throughout evolution. Comparative genomic analyses can provide insights into the evolutionary history and functional divergence of LRRC70 from other LRR proteins.

The functional relationships between LRRC70 and other LRR proteins remain to be fully elucidated, but patterns observed in the LRR protein family suggest LRRC70 may participate in:

  • Specific protein recognition and binding

  • Assembly of multi-protein signaling complexes

  • Modulation of signal transduction pathways

  • Potentially regulating cellular processes like trafficking, similar to LRRK1's role in endosomal transport

Research on LRRK1 has shown that specific structural features, such as the extended αC helix that forms unique contacts with the COR-B domain, are critical for its function . Similar structural features might exist in LRRC70, potentially defining its specific interactions and functions.

What expression systems are suitable for producing recombinant human LRRC70?

Selecting the appropriate expression system is critical for successful production of functional recombinant human LRRC70. Based on experience with related leucine-rich repeat proteins, several expression platforms should be considered, each with distinct advantages for different research applications:

Expression SystemAdvantagesDisadvantagesTypical YieldRecommended For
Mammalian (HEK293, CHO)Native folding environment, proper PTMs, natural chaperonesHigher cost, longer production time, lower yields1-10 mg/LFull-length LRRC70, functional studies
Insect Cell (Sf9, Sf21)Higher yield than mammalian, proper protein folding, eukaryotic PTMsModerate cost, complex setup, different glycosylation5-50 mg/LFull-length protein, structural studies
Bacterial (E. coli)High yield, low cost, rapid expressionLimited PTMs, folding challenges with complex proteins10-100 mg/LIndividual domains, truncated constructs
Cell-FreeRapid production, handles toxic proteinsLower yield, higher cost, limited scale0.1-1 mg/mLInitial screening, domain analysis

For full-length human LRRC70, mammalian expression systems typically provide the most reliable results. The pcDNA3.1+/C-(K)DYK vector or similar mammalian expression vectors with C-terminal tags have been successfully used for related LRR proteins . This approach facilitates proper folding and potential post-translational modifications that may be essential for LRRC70 function.

When designing expression constructs, several modifications can enhance success:

  • Codon optimization for the selected expression host

  • Inclusion of purification tags (His6, FLAG, or DYKDDDDK) at N- or C-terminus

  • Consideration of fusion partners (SUMO, MBP, GST) to enhance solubility

  • Incorporation of cleavage sites for tag removal

  • Optional signal sequences for secretion in eukaryotic systems

For challenging expression cases, dividing LRRC70 into functional domains may improve expression yields and stability. The leucine-rich repeat domains could be expressed separately from other regions, allowing domain-specific studies while simplifying protein production.

What purification strategies are effective for recombinant human LRRC70?

Purification of recombinant human LRRC70 typically requires a multi-step approach to achieve high purity while maintaining protein activity. Based on successful purification strategies for related leucine-rich repeat proteins, the following workflow is recommended:

  • Initial Extraction and Clarification:

    • For mammalian or insect cells: Gentle lysis using detergent-based buffers (0.5-1% NP-40 or Triton X-100)

    • For bacterial systems: Mechanical disruption or chemical lysis

    • Clarification by high-speed centrifugation (20,000-30,000 × g for 30-45 minutes)

    • Filtration through 0.45 μm or 0.22 μm filters

  • Affinity Chromatography (primary capture):

    • For FLAG/DYKDDDDK-tagged LRRC70: Anti-FLAG affinity resin

    • For His-tagged constructs: Immobilized metal affinity chromatography (IMAC)

    • Typical elution conditions: Competitive elution with FLAG peptide or imidazole gradient

    • Gentle elution conditions help preserve protein structure and activity

  • Intermediate Purification:

    • Ion exchange chromatography based on LRRC70's theoretical isoelectric point

    • Anion exchange (Q Sepharose) if pI < 7.0, cation exchange (SP Sepharose) if pI > 7.0

    • Salt gradient elution (typically 50-500 mM NaCl)

  • Polishing Step:

    • Size exclusion chromatography (Superdex 200 or similar matrix)

    • Effective for separating monomeric LRRC70 from aggregates and contaminants

    • Also allows buffer exchange to final storage formulation

  • Quality Control Assessment:

    • SDS-PAGE with Coomassie or silver staining to assess purity

    • Western blotting to confirm identity

    • Dynamic light scattering to evaluate homogeneity

    • Thermal shift assay to assess stability (similar to methods used for LRRK1)

Throughout the purification process, maintaining protein stability is crucial. Based on experience with related proteins, recommended buffer conditions include:

  • 20-50 mM Tris or HEPES, pH 7.4-8.0

  • 150-300 mM NaCl to maintain solubility

  • 1-5 mM DTT or 0.5-2 mM TCEP as reducing agents

  • 5-10% glycerol to prevent aggregation

  • Protease inhibitor cocktail during early purification stages

For particularly challenging purifications, detergent screening (using non-ionic detergents at concentrations below CMC) may improve protein behavior during chromatography steps.

How can I verify the activity and structural integrity of purified LRRC70?

Verifying both the structural integrity and functional activity of purified recombinant human LRRC70 is essential to ensure that the protein retains its native properties. A comprehensive validation approach should include both biophysical characterization and functional assessments.

Structural Integrity Assessment:

  • Secondary Structure Analysis:

    • Circular Dichroism (CD) spectroscopy to confirm the presence of expected secondary structure elements

    • Expected spectrum for LRR proteins: Strong negative bands at 208-210 nm and 222 nm (α-helical content) and positive band at 195-200 nm

  • Thermal Stability Analysis:

    • Differential Scanning Fluorimetry (DSF) or Thermal Shift Assay (TSA) to determine melting temperature (Tm)

    • Monitoring changes in Tm (ΔTm) in response to buffer conditions or binding partners, similar to analyses performed with LRRK1

    • Expected Tm for stable LRR proteins: 50-65°C in optimized buffer conditions

  • Homogeneity Assessment:

    • Size Exclusion Chromatography coupled with Multi-Angle Light Scattering (SEC-MALS) to confirm molecular weight and oligomeric state

    • Dynamic Light Scattering (DLS) to evaluate polydispersity and detect aggregation

    • Native PAGE or blue native PAGE to assess oligomeric state

Functional Validation Approaches:

For LRRC70, drawing parallels from LRRK1 studies, a particularly informative approach would be to combine thermal stability measurements with protein-protein interaction studies . This combination can reveal how binding events affect protein conformation and stability, providing insights into LRRC70's functional mechanisms.

How should I design RNA-Seq experiments to study LRRC70 expression patterns?

Designing effective RNA-Seq experiments to investigate LRRC70 expression patterns requires careful planning of experimental conditions, sample preparation, and data analysis approaches. Based on established RNA-Seq guidelines , the following comprehensive strategy is recommended:

Experimental Design Considerations:

  • Research Question Refinement:

    • Define specific objectives: tissue-specific expression patterns, response to stimuli, developmental regulation, etc.

    • Determine whether focus is on differential expression, alternative splicing, or both

    • Consider whether to explore regulatory mechanisms (promoter usage, enhancer activity)

  • Sample Selection and Replication:

    • Include sufficient biological replicates (minimum 3-5 per condition) to account for biological variability

    • For human samples: consider demographic factors (age, sex, genetic background)

    • For cell lines: use multiple passages or independent cultures

    • Include appropriate temporal sampling for dynamic processes

  • Experimental Conditions:

    • Define clear experimental and control groups

    • For stimulus-response studies: include appropriate time points (e.g., 0, 2, 6, 12, 24 hours)

    • For tissue-specific expression: include multiple relevant tissues and appropriate reference tissues

Experimental Design ElementBasic ApproachAdvanced Approach
Biological Replicates3 per condition5-6 per condition
Technical ReplicationSingle sequencing runSequencing replicates for key samples
Read Depth20-30 million reads/sample50-100 million reads/sample for splicing analysis
Read ConfigurationSingle-end 75bpPaired-end 150bp for improved mapping
ControlsUntreated/wild-type samplesInclude both positive and negative controls

Sample Preparation and Sequencing:

  • RNA Extraction and Quality Control:

    • Use standardized RNA extraction protocols to minimize technical variability

    • Verify RNA integrity using Bioanalyzer or TapeStation (RIN > 8 recommended)

    • Quantify RNA using fluorometric methods (Qubit or similar)

  • Library Preparation Strategy:

    • For coding gene focus: polyA selection to enrich for mRNAs

    • For comprehensive transcriptome: rRNA depletion to include non-coding RNAs

    • Consider strand-specific protocols to distinguish sense/antisense transcription

    • For splicing analysis: adequate read length (minimum paired-end 100bp)

  • Sequencing Platform and Parameters:

    • Illumina platforms are standard for most RNA-Seq applications

    • Minimum 30 million reads per sample for differential expression analysis

    • 50-100 million reads for detailed splicing analysis or low-abundance transcript detection

Data Analysis Pipeline:

  • Quality Control and Preprocessing:

    • Raw data QC using FastQC or MultiQC

    • Adapter trimming and low-quality read filtering

    • Contamination screening

  • Alignment and Quantification:

    • Genome alignment using STAR or HISAT2

    • Transcript quantification using featureCounts, HTSeq, or salmon

    • For novel isoform discovery: Stringtie or Cufflinks assembly

  • Differential Expression Analysis:

    • Statistical testing using DESeq2, edgeR, or limma-voom

    • Multiple testing correction (Benjamini-Hochberg FDR)

    • Visualization of LRRC70 expression patterns across conditions

  • Functional Analysis:

    • Co-expression network analysis to identify genes with similar patterns to LRRC70

    • Pathway enrichment analysis of co-expressed genes

    • Regulatory motif analysis of the LRRC70 promoter region

  • Validation Strategy:

    • RT-qPCR validation of LRRC70 expression changes

    • Protein-level validation using Western blot or immunohistochemistry

    • Functional validation through perturbation experiments

This comprehensive approach ensures generation of high-quality, interpretable data for understanding LRRC70 expression patterns across different biological contexts .

What are the key considerations for studying LRRC70 interactions with other proteins?

Investigating the protein interaction network of LRRC70 requires a systematic approach that combines complementary methods to identify, validate, and characterize interactions. Based on strategies employed for related leucine-rich repeat proteins, the following multi-tiered approach is recommended:

Identification of Potential Interaction Partners:

  • Bioinformatic Prediction Approaches:

    • Structural homology modeling based on related LRR proteins

    • Protein-protein interaction prediction algorithms (STRING, PrePPI)

    • Co-expression analysis across tissue and cell types

    • Evolutionary conservation of potential interaction interfaces

  • Unbiased Screening Methods:

    • Affinity purification coupled with mass spectrometry (AP-MS)

    • Proximity labeling techniques (BioID, APEX) in relevant cellular contexts

    • Yeast two-hybrid screening using LRRC70 as bait

    • Protein complementation assays (split-luciferase, split-GFP)

  • Candidate Approach:

    • Based on knowledge of LRR protein interaction partners

    • Focus on proteins in pathways where LRRC70 is implicated

    • Consider proteins that co-localize with LRRC70 in cells

Validation and Characterization of Interactions:

  • In Vitro Binding Studies:

    • Pull-down assays with purified recombinant proteins

    • Surface Plasmon Resonance (SPR) for kinetic and affinity measurements

    • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters

    • AlphaScreen or ELISA-based assays for high-throughput validation

  • Cellular Validation:

    • Co-immunoprecipitation from cell lysates

    • Fluorescence Resonance Energy Transfer (FRET)

    • Bimolecular Fluorescence Complementation (BiFC)

    • Proximity Ligation Assay (PLA) for endogenous proteins

  • Structural Characterization:

    • Co-crystallization of LRRC70 with binding partners

    • Cryo-EM analysis of complexes

    • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS) to map binding interfaces

    • Cross-linking Mass Spectrometry (XL-MS) to identify contact points

Functional Analysis of Interactions:

  • Mutational Analysis:

    • Structure-guided mutagenesis of predicted interface residues

    • Creation of interface mutants to disrupt specific interactions

    • Assessment of how mutations affect binding using quantitative assays

  • Domain Mapping:

    • Expression of individual LRRC70 domains to identify minimal binding regions

    • Peptide arrays to pinpoint specific binding motifs

    • Competition assays with domain-specific peptides

  • Regulatory Mechanisms:

    • Investigation of how post-translational modifications affect interactions

    • Analysis of how binding is regulated by cellular conditions

    • Temporal dynamics of complex formation

Learning from LRRK1 studies, specific regions in LRRC70 may be particularly important for protein interactions. For example, the extended αC helix in LRRK1 forms unique contacts with other domains, and mutations in this region significantly impact function . Similar structural features in LRRC70 might represent critical interaction interfaces worth targeting in mutagenesis studies.

Additionally, the regulation of interactions through phosphorylation could be particularly relevant, as seen with LRRK1 where phosphorylation by PKC leads to kinase activation . Investigating whether LRRC70 undergoes similar regulatory phosphorylation would provide insights into dynamic aspects of its interactions.

How can mutations in LRRC70 affect its structure and function?

Mutations in LRRC70 can have profound effects on its structure and function, potentially altering protein stability, interaction capabilities, and cellular activities. Drawing from studies of related leucine-rich repeat proteins, particularly LRRK1 , several patterns of mutation effects can be anticipated:

Structural Consequences of Mutations:

  • Core Structural Mutations:

    • Mutations in conserved leucine residues within LRR motifs can disrupt the hydrophobic core

    • Changes in consensus residues may distort the characteristic curved LRR architecture

    • Mutations affecting domain interfaces can alter relative orientation of functional regions

  • Stability Effects:

    • Many mutations in LRR proteins result in measurable changes in thermal stability

    • Similar to LRRK1, where mutations showed varying effects on melting temperature (ΔTm)

    • Destabilizing mutations often reduce protein half-life in cells

  • Conformational Changes:

    • Mutations can shift equilibrium between different conformational states

    • Some mutations may lock the protein in specific conformations

    • Changes in flexible regions can alter dynamic properties crucial for function

Mutation TypeRegionExpected Structural EffectFunctional ConsequenceDetection Method
Hydrophobic coreLRR domainDisrupted folding, decreased stabilityLoss of function, aggregationThermal shift (ΔTm -2 to -5°C)
Surface residueExposed LRRMinimal structural effectAltered protein-protein interactionsBinding assays, unchanged Tm
Interface residueDomain boundaryChanged domain orientationModified regulation/activityCombined structural/functional analysis
Regulatory sitePhosphorylation siteAltered response to signalingChanged activation thresholdPhospho-specific assays

Functional Implications of LRRC70 Mutations:

  • Effects on Protein-Protein Interactions:

    • Mutations at binding interfaces can enhance or disrupt specific interactions

    • Changes in surface properties may alter binding specificity

    • Mutations might create novel interaction capabilities

  • Impact on Cellular Localization:

    • Mutations can affect trafficking signals or binding to localization factors

    • Similar to LRRK1, where activating mutations (K746G, Y971F) increased colocalization with endosomal markers

    • Mislocalization can disrupt access to relevant binding partners

  • Regulatory Consequences:

    • Mutations at phosphorylation sites can create phosphomimetic (e.g., S→D/E) or phospho-null (S→A) effects

    • Changes in regulatory interfaces may alter response to cellular signals

    • Some mutations may cause constitutive activation or inhibition

Experimental Approaches to Study LRRC70 Mutations:

  • Rational Mutation Design:

    • Structure-guided mutagenesis targeting key residues

    • Creation of equivalent mutations to those characterized in related proteins

    • Alanine-scanning mutagenesis of predicted functional regions

  • Functional Classification:

    • Categorization of mutations as loss-of-function, gain-of-function, or neutral

    • Assessment of dominant-negative effects in cellular contexts

    • Comparison with natural variants identified in population databases

  • Comprehensive Phenotyping:

    • Biochemical characterization (stability, binding properties)

    • Cellular localization and trafficking analysis

    • Effects on downstream signaling pathways

From LRRK1 studies, mutations like M1298K revealed that introducing new stabilizing contacts between domains can significantly enhance activity . This suggests that interface mutations in LRRC70 might similarly alter interdomain communication. Additionally, the Y971F mutation in LRRK1 demonstrated how removing a single phosphorylation site can dramatically impact function , highlighting the importance of investigating post-translational modification sites in LRRC70.

What are common challenges in expressing recombinant human LRRC70?

Expressing recombinant human LRRC70 can present several challenges due to its complex multi-domain structure and specific folding requirements. Researchers frequently encounter the following issues, for which targeted solutions are provided:

Expression Yield Challenges:

  • Low Expression Levels:

    • Challenge: LRR proteins often express poorly in heterologous systems

    • Solution: Optimize codon usage for the expression host; use strong, inducible promoters; test expression at different temperatures (16-30°C)

    • Advanced Approach: Screen multiple fusion tags (SUMO, MBP, GST) to identify constructs with enhanced expression

  • Toxicity to Host Cells:

    • Challenge: Expression may be toxic, particularly in bacterial systems

    • Solution: Use tightly controlled inducible promoters; reduce inducer concentration; test low-copy number vectors

    • Advanced Approach: Consider cell-free expression systems for initial protein production screening

  • Truncated Products:

    • Challenge: Premature termination during translation

    • Solution: Optimize rare codons; ensure mRNA stability; check for cryptic termination sites

    • Advanced Approach: Use Western blotting with antibodies against N- and C-terminal tags to identify truncation points

Protein Solubility and Folding Issues:

  • Inclusion Body Formation:

    • Challenge: Protein aggregation in bacterial systems

    • Solution: Lower expression temperature (16-18°C); co-express molecular chaperones (GroEL/ES, DnaK/J)

    • Advanced Approach: Develop refolding protocols from solubilized inclusion bodies if necessary

  • Misfolding in Eukaryotic Systems:

    • Challenge: Improper folding despite eukaryotic expression

    • Solution: Add chemical chaperones to media (glycerol, TMAO); optimize growth conditions

    • Advanced Approach: Consider domain-by-domain expression to identify problematic regions

  • Poor Secretion:

    • Challenge: Inefficient secretion with signal sequences

    • Solution: Test different signal peptides; optimize secretion conditions

    • Advanced Approach: Compare intracellular retention vs. secreted fractions to identify bottlenecks

Construct Design Considerations:

  • Domain Boundary Selection:

    • Challenge: Improper domain boundaries leading to unstable proteins

    • Solution: Use bioinformatic prediction tools; create multiple constructs with different boundaries

    • Advanced Approach: Perform limited proteolysis on full-length protein to identify stable domains

  • Tag Interference:

    • Challenge: Purification tags affecting folding or function

    • Solution: Test both N- and C-terminal tag positions; use small tags initially

    • Advanced Approach: Include removable tags with specific protease sites

  • Flexible Linker Regions:

    • Challenge: Flexible regions causing heterogeneity or degradation

    • Solution: Design constructs that exclude predicted disordered regions

    • Advanced Approach: Create internal deletions of flexible regions while maintaining domain integrity

For LRRC70, drawing parallels from successful expression of related LRR proteins, mammalian expression systems like HEK293 cells with vectors such as pcDNA3.1+/C-(K)DYK likely offer the best starting point. Insect cell expression provides a good alternative with potentially higher yields while maintaining eukaryotic folding machinery. Successful expression often requires empirical optimization of multiple parameters simultaneously.

How can I optimize the stability of purified LRRC70?

Optimizing the stability of purified recombinant human LRRC70 is critical for maintaining its structural integrity and functional activity during storage and experimental procedures. A systematic approach to stability optimization involves buffer formulation, handling procedures, and appropriate validation methods:

Buffer Optimization Strategy:

  • Systematic Buffer Screening:

    • Test various buffer systems (HEPES, Tris, phosphate) at pH ranges 6.5-8.5

    • Optimize ionic strength with different NaCl concentrations (100-500 mM)

    • Screen stabilizing additives systematically

Buffer ComponentRange to TestEffect on StabilityMonitoring Method
pH6.5, 7.0, 7.5, 8.0, 8.5Affects surface charge, solubilityThermal shift assay, visual inspection
NaCl100, 150, 250, 500 mMScreens electrostatic interactionsSEC profile, DLS, thermal stability
Glycerol0%, 5%, 10%, 20%Prevents aggregation, stabilizes hydrophobic regionsLong-term stability at 4°C and -20°C
Reducing agents1-5 mM DTT, 0.5-2 mM TCEPPrevents oxidation of cysteinesSDS-PAGE under non-reducing conditions
Additives50-200 mM L-Arginine, 50-100 mM TrehalosePrevents aggregation through different mechanismsDLS, visual inspection, activity retention
  • Thermal Stability Assessment:

    • Use differential scanning fluorimetry (thermal shift assay) to measure melting temperature (Tm)

    • Systematically evaluate how different buffer components affect Tm

    • Similar to approaches used for LRRK1, where mutations and conditions produced measurable changes in thermal stability (ΔTm)

  • Time-Course Stability Studies:

    • Monitor protein stability over time (0, 1, 3, 7, 14 days)

    • Assess multiple storage temperatures (4°C, -20°C, -80°C)

    • Evaluate freeze-thaw stability (1, 3, 5 cycles)

Storage and Handling Recommendations:

  • Concentration Considerations:

    • Determine optimal protein concentration range (typically 0.5-5 mg/mL)

    • Test stability at different concentrations to identify aggregation thresholds

    • Consider storage at higher concentrations with dilution before use

  • Storage Format Options:

    • Small aliquots to minimize freeze-thaw cycles

    • Flash-freezing in liquid nitrogen versus slow freezing

    • Addition of carrier proteins (0.1-1 mg/mL BSA) for dilute samples

  • Long-Term Preservation Methods:

    • Evaluate lyophilization with appropriate cryoprotectants

    • Test storage in 50% glycerol at -20°C for enzyme-free preservation

    • Consider immobilization on solid supports for some applications

Stability Validation Methods:

  • Physical Stability Indicators:

    • Size exclusion chromatography to monitor aggregation

    • Dynamic light scattering to detect early aggregation events

    • Visual inspection for precipitation or opalescence

  • Functional Stability Assessment:

    • Binding assays with known interaction partners

    • Activity assays if enzymatic function is established

    • Circular dichroism to monitor secondary structure retention

  • Chemical Stability Analysis:

    • Mass spectrometry to detect modifications (oxidation, deamidation)

    • SDS-PAGE under reducing and non-reducing conditions

    • Isoelectric focusing to identify charge variants

What controls should be included in experiments involving LRRC70?

Designing rigorous controls is essential for generating reliable and interpretable data in LRRC70 research. Appropriate controls must be implemented at each experimental stage, from protein production to functional characterization:

Controls for Protein Expression and Purification:

  • Expression Controls:

    • Empty vector control processed in parallel to assess background proteins

    • Well-characterized control protein expressed under identical conditions

    • Time-course sampling to determine optimal expression period

  • Purification Quality Controls:

    • SDS-PAGE analysis of each purification step to monitor purification efficiency

    • Western blot confirmation of protein identity

    • Mass spectrometry verification of intact mass and sequence coverage

    • Endotoxin testing for proteins intended for cellular experiments

  • Batch-to-Batch Consistency:

    • Analytical SEC comparison between batches

    • Thermal stability comparison (Tm values within ±1°C)

    • Activity/binding assay standardization

    • Reference standard maintenance for long-term projects

Controls for Functional and Interaction Studies:

  • Protein-Protein Interaction Controls:

    • Negative control: Unrelated protein with similar size/tag

    • Positive control: Known interacting protein pair

    • Competitive binding with unlabeled protein to demonstrate specificity

    • Binding to denatured target to assess non-specific interactions

  • Mutational Analysis Controls:

    • Conservative mutations as negative controls

    • Known functional mutations in related proteins as positive controls

    • Surface mutations distant from functional sites as specificity controls

    • Wild-type protein processed in parallel with all mutants

  • Cellular Localization Studies:

    • Co-localization with established compartment markers

    • Non-expressing cells within the same field for background assessment

    • Fluorescent tag-only control to rule out tag-driven localization

    • Wild-type protein for comparison with mutant variants

Controls for RNA-Seq and Expression Studies:

  • Technical Controls:

    • RNA spike-in controls for normalization

    • RT-qPCR validation of key findings from RNA-Seq

    • Housekeeping genes as internal reference controls

    • Biological replicates to assess reproducibility

  • Experimental Design Controls:

    • Time-matched controls for temporal studies

    • Appropriate vehicle controls for treatments

    • Scrambled siRNA controls for knockdown experiments

    • Isogenic cell lines for genetic modification studies

Validation Through Multiple Approaches:

  • Orthogonal Method Validation:

    • Confirm key findings using independent techniques

    • For interaction studies: combine in vitro binding with cellular co-localization

    • For functional effects: link biochemical changes to cellular phenotypes

  • Statistical Validation:

    • Appropriate statistical tests based on data distribution

    • Multiple testing correction for high-throughput experiments

    • Power analysis to ensure adequate sample sizes

    • Blinded analysis when possible to reduce experimenter bias

Drawing from LRRK1 research, where multiple approaches were used to validate findings , a particularly valuable control strategy is to create a set of LRRC70 variants with predicted effects: a putative inactive mutant (equivalent to the K1270M kinase-dead LRRK1 mutant), an anticipated hyperactive mutant, and interface mutants that alter protein interactions. These variants can serve as internal controls across different experimental platforms, creating a consistent framework for data interpretation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.