Recombinant Human Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 2 (LRIT2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us for preferential development.
Synonyms
LRIT2; LRRC22; Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 2; Leucine-rich repeat-containing protein 22
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-550
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
LRIT2
Target Protein Sequence
AQPFCLPGCTCSEESFGRTLQCTSVSLGKIPGNLSEEFKQVRIENSPLFEMPQGSFINMS TLEYLWLNFNNISVIHLGALEHLPELRELRLEGNKLCSVPWTAFRATPLLRVLDLKRNKI DALPELALQFLVSLTYLDLSSNRLTVVSKSVFLNWPAYQKCRQPDCGAEILSSLVVALHD NPWVCDCRLRGLVQFVKSITLPVILVNSYLICQGPLSKAGQLFHETELSACMKPQISTPS ANITIRAGQNVTLRCLAQASPSPSIAWTYPLSMWREFDVLTSSTGEDTALSELAIPAAHL VDSGNYTCMASNSIGKSNLVISLHVQPAQALHAPDSLSIPSEGNAYIDLRVVKQTVHGIL LEWLAVADTSKEEWFTLYIASDEAFRKEVVHIGPGINTYAVDDLLPGTKYEACLSLEGQP PHQGQCVAFVTGRDAGGLEAREHLLHVTVVLCVVLLAVPVGAYAWAAQGPCSCSKWVLRG CLHRRKAPSCTPAAPQSKDGSFREHPAVCDDGEGHIDTEGDKEKGGTEDNS
Uniprot No.

Target Background

Gene References Into Functions
  1. Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) PMID: 20379614
  2. Observational study of gene-disease association. (HuGE Navigator) PMID: 20237496
Database Links

HGNC: 23443

KEGG: hsa:340745

STRING: 9606.ENSP00000361185

UniGene: Hs.450425

Subcellular Location
Membrane; Single-pass type I membrane protein.

Q&A

What is the domain organization of human LRIT2 protein?

Human LRIT2 is a multi-domain protein containing leucine-rich repeats (LRRs), an immunoglobulin-like domain, and a transmembrane domain. According to the UniProt database, LRIT2 is a precursor protein categorized as LRIT2_HUMAN with the following domain architecture:

  • N-terminal signal peptide

  • Multiple leucine-rich repeat motifs forming the LRR domain

  • Immunoglobulin-like (Ig-like) domain

  • Transmembrane domain

  • Short C-terminal cytoplasmic region

The protein has additional designation as LRRC22 (Leucine-rich repeat containing 22) in some databases and literature .

What is the predicted molecular weight of recombinant human LRIT2?

Recombinant human LRIT2 expressed in mammalian cells typically has a molecular weight of approximately 60 kDa as determined by SDS-PAGE analysis. This may vary slightly depending on post-translational modifications and the specific expression system used. When tagged (e.g., with Myc-DYKDDDDK), the apparent molecular weight on SDS-PAGE will be higher than the predicted weight of the native protein .

What is known about LRIT2 expression patterns in human tissues?

LRIT2 shows tissue-specific expression patterns, with notable presence in photoreceptor cells of the retina. Chromatin immunoprecipitation studies have identified CRX (cone-rod homeobox) binding regions in the LRIT2 promoter, suggesting regulation by this photoreceptor-specific transcription factor. Specifically, LRIT2-CBR2 located in the immediate upstream promoter region of LRIT2 has been shown to drive strong photoreceptor-specific expression .

What expression systems are optimal for producing functional recombinant human LRIT2?

Based on available research data, HEK293 cells are a preferred expression system for recombinant human LRIT2 production. This mammalian expression system provides several advantages for LRIT2 expression:

  • Proper protein folding of complex multi-domain structures

  • Appropriate post-translational modifications

  • Higher probability of obtaining correctly folded transmembrane domains

Commercially available recombinant LRIT2 is typically expressed in HEK293 cells using strong CMV promoters, yielding protein with >80% purity as determined by SDS-PAGE and Coomassie blue staining .

What purification strategies yield the highest purity for recombinant LRIT2?

For optimal purification of recombinant LRIT2, a multi-step chromatography approach is recommended:

  • Initial capture: Affinity chromatography using the C-terminal tag (e.g., DYKDDDDK/FLAG tag or His tag)

  • Intermediate purification: Ion exchange chromatography to separate charged variants

  • Polishing step: Size exclusion chromatography to remove aggregates and achieve >90% purity

Purified protein is typically stored in a stabilizing buffer containing 25 mM Tris-HCl (pH 7.3), 100 mM glycine, and 10% glycerol at -80°C . Limited freeze-thaw cycles (2-3 maximum) are recommended to maintain protein integrity.

How should researchers assess the quality and functionality of purified recombinant LRIT2?

A comprehensive quality assessment protocol for recombinant LRIT2 should include:

  • Purity analysis: SDS-PAGE with Coomassie staining (target >80% purity)

  • Identity confirmation: Western blot using specific anti-LRIT2 antibodies

  • Structural integrity: Circular dichroism to verify proper secondary structure

  • Functional assessment: ELISA-based binding assays or cell-based reporter assays

For applications requiring higher purity standards, additional analytical methods such as Maurice CE-SDS PLUS for size separation and Maurice icIEF for charge variant analysis can be implemented, similar to quality control methods used for other recombinant proteins .

How can recombinant LRIT2 be utilized in studies of photoreceptor gene regulation?

Recombinant LRIT2 can be leveraged in photoreceptor regulation studies through:

  • Promoter analysis experiments: Using the LRIT2 promoter region (particularly LRIT2-CBR2) to drive reporter gene expression in photoreceptor cells, as demonstrated in studies where this region drove strong photoreceptor-specific expression .

  • Protein-protein interaction studies: Identifying binding partners of LRIT2 in photoreceptor cells using pull-down assays with recombinant LRIT2 as bait.

  • ChIP-seq validation: Recombinant LRIT2 can be used as a standard in quantitative analyses validating CRX binding sites in the LRIT2 regulatory regions.

CRX ChIP-seq studies have identified multiple CRX-bound regions (CBRs) around the LRIT2 locus, with LRIT2-CBR2 in the immediate upstream promoter driving strong photoreceptor-specific expression, while LRIT2-CBR1 showed weaker activity .

What are the best methodologies for studying LRIT2 interactions with other proteins?

To investigate LRIT2 protein interactions, researchers should consider these methodologies:

  • Co-immunoprecipitation (Co-IP): Using anti-tag antibodies (when working with tagged recombinant LRIT2) or specific anti-LRIT2 antibodies to pull down protein complexes from cell lysates.

  • Proximity labeling approaches: BioID or APEX2 fusion proteins can identify proximal interacting partners in living cells.

  • Surface plasmon resonance (SPR): For quantitative binding kinetics of purified recombinant LRIT2 with candidate interaction partners.

  • Yeast two-hybrid screening: Similar to approaches used for other leucine-rich repeat proteins like LRRK2, which identified self-interaction domains .

When designing these experiments, it's important to consider which domains of LRIT2 might mediate specific interactions. The leucine-rich repeat domain likely plays a significant role in protein-protein interactions, as observed with other LRR-containing proteins which utilize these regions for activities requiring protein interactions .

What cellular assays can effectively assess LRIT2 function?

Functional assessment of LRIT2 can be performed using these cellular assays:

  • Retinal cell models: Electroporation of LRIT2 expression constructs into mouse retina to assess effects on photoreceptor development and function, similar to methods used to test CBR-reporter fusions .

  • Transmembrane signaling assays: Reporter systems coupled to LRIT2 activation to measure downstream signaling events.

  • Subcellular localization studies: Immunofluorescence microscopy using fluorescently-tagged LRIT2 to determine its distribution in relevant cell types.

For retina-specific studies, the electroporation method described in previous research has shown that 52% (14/27) of individual CBRs tested drove detectable expression in photoreceptors, with at least one positive CBR being detected around 92% (12/13) of all loci examined .

How does the structure of LRIT2 relate to other leucine-rich repeat containing proteins?

LRIT2 belongs to the broader family of leucine-rich repeat (LRR) containing proteins, which share structural similarities but perform diverse functions. The structural comparison with other LRR proteins reveals:

  • Like other LRR proteins, LRIT2 contains repeating structural motifs with high leucine content that form characteristic horseshoe-shaped structures.

  • LRIT2 differs from other LRR proteins like LRRK2 in that it contains an immunoglobulin-like domain and a transmembrane domain, suggesting membrane localization and potential immune-related functions.

  • The leucine-rich regions in proteins like LRIT2 are involved in protein-protein interactions, similar to LRRK2's leucine-rich region which plays a role in activities requiring interactions with other proteins .

Algorithms developed for LRR protein analysis use Hidden Markov Models (HMMs) to identify the positions and class assignments of LRRs, capturing both regular and "irregular" LRRs with atypical amino acid sequences .

What methodologies are recommended for investigating LRIT2 in neurodevelopmental contexts?

To study LRIT2 in neurodevelopment:

  • Time-series expression analysis: Tracking LRIT2 expression during critical developmental windows using qPCR or RNA-seq approaches. This can be modeled after developmental time series studies conducted for other genes in retinal tissue .

  • CRISPR-Cas9 genome editing: Generating LRIT2 knockout or knock-in models to assess functional consequences during development.

  • Organoid models: Using retinal organoids to study LRIT2 function in a three-dimensional context that better recapitulates in vivo development.

  • Cross-species transcriptome analysis: Comparing LRIT2 expression patterns across species at different developmental timepoints, similar to multi-species transcriptome databases for other tissues .

When designing these studies, it's important to consider the lighting conditions as these can affect gene expression in photoreceptors. Previous research has incorporated lighting variables (L:D cycles, constant darkness) in experimental designs .

How can post-translational modifications of LRIT2 be investigated?

Investigating post-translational modifications (PTMs) of LRIT2 requires specialized techniques:

  • Mass spectrometry-based approaches:

    • Tryptic digestion followed by LC-MS/MS analysis

    • Enrichment strategies for specific PTMs (phosphopeptides, glycopeptides)

    • Targeted multiple reaction monitoring (MRM) for quantitative PTM profiling

  • Site-directed mutagenesis: Creating variants at predicted PTM sites to assess functional consequences.

  • PTM-specific antibodies: When available, these can be used for western blotting, immunoprecipitation, or immunofluorescence.

  • PTM prediction tools: Computational prediction of potential PTM sites based on sequence analysis and structural models.

The iPTMnet database approach used for other proteins could be adapted to catalog PTMs identified on LRIT2 .

What are common challenges in expressing and purifying recombinant LRIT2, and how can they be addressed?

Researchers frequently encounter these challenges when working with recombinant LRIT2:

  • Low expression yields:

    • Solution: Optimize codon usage for the expression system

    • Evaluate different signal peptides

    • Test expression as a fusion protein with solubility enhancers

  • Protein aggregation:

    • Solution: Modify buffer conditions (pH, salt concentration)

    • Include stabilizing agents such as glycerol (10%)

    • Optimize purification to minimize time at room temperature

  • Proteolytic degradation:

    • Solution: Include protease inhibitor cocktails during purification

    • Consider C-terminal tag placement to detect full-length protein

    • Optimize cell lysis conditions to minimize exposure to endogenous proteases

  • Improper folding of the transmembrane domain:

    • Solution: Express the extracellular domain only for certain applications

    • Consider detergent screening for full-length protein purification

    • Explore nanodiscs or liposome reconstitution for functional studies

Storage recommendations include maintaining the protein at -80°C in buffer containing 25 mM Tris-HCl (pH 7.3), 100 mM glycine, and 10% glycerol, with limited freeze-thaw cycles .

How can researchers validate antibody specificity when working with LRIT2?

Robust antibody validation for LRIT2 research should include:

  • Positive and negative controls:

    • Positive: Cell lines overexpressing recombinant LRIT2

    • Negative: LRIT2 knockout cell lines or tissues

    • Competition assays with purified recombinant LRIT2

  • Cross-reactivity assessment:

    • Testing against related LRR-containing proteins

    • Evaluation in tissues known to express or lack LRIT2

  • Multiple antibody concordance:

    • Using antibodies targeting different epitopes of LRIT2

    • Comparing monoclonal and polyclonal antibody results

  • Application-specific validation:

    • For Western blot: Confirm molecular weight matches prediction

    • For immunohistochemistry: Pattern matches known expression

    • For immunoprecipitation: Mass spectrometry confirmation

Recombinant LRIT2 protein can serve as a valuable positive control for antibody validation in applications such as ELISA and other antibody assays .

What considerations are important when designing functional studies for LRIT2 in different model systems?

When designing functional studies for LRIT2 across different model systems, researchers should consider:

  • Species-specific variations:

    • Sequence homology assessment between human LRIT2 and the model organism's ortholog

    • Expression pattern differences between species

    • Cross-species transcriptome analysis to inform experimental design

  • Temporal expression dynamics:

    • Developmental timing of LRIT2 expression

    • Circadian regulation considerations, especially for retinal studies

    • Age-dependent effects in adult models

  • Cell type specificity:

    • Targeting experiments to relevant LRIT2-expressing cell populations

    • Single-cell analysis approaches for heterogeneous tissues

    • Conditional expression systems for tissue-specific manipulation

  • Readout selection:

    • Molecular: Changes in gene expression profiles

    • Cellular: Morphological alterations, protein localization

    • Functional: Electrophysiological measurements in retinal models

Cross-species transcriptome studies have revealed significant differences in gene expression patterns among species, highlighting the importance of not making generalities based on studies of a single species .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.