Recombinant Human Leukotriene-B (4) omega-hydroxylase 2 (CYP4F3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Leukotriene-B (4) omega-hydroxylase 2 (CYP4F3)

Recombinant Human Leukotriene-B (4) omega-hydroxylase 2, also known as Cytochrome P450 4F3 (CYP4F3), is an enzyme encoded by the CYP4F3 gene in humans . Cytochrome P450 proteins, such as CYP4F3, are monooxygenases that catalyze various reactions involved in synthesizing cholesterol, steroids, fatty acids, and drug metabolism .

The CYP4F3 gene encodes two distinct enzymes, CYP4F3A and CYP4F3B, which result from the alternative splicing of a single pre-mRNA molecule . The selection of either isoform is tissue-specific, with CYP4F3A primarily expressed in leukocytes, while CYP4F3B is mainly expressed in the liver . Both variants are located on the endoplasmic reticulum and metabolize leukotriene B4 and likely 5-hydroxyeicosatetraenoic acid, 5-oxo-eicosatetraenoic acid, and 12-hydroxyeicosatetraenoic acid through omega oxidation, adding a hydroxyl residue to their terminal carbon .

Gene and Protein Structure

The CYP4F3 gene is located on chromosome 19 at position 19p13.2 . This gene contains 13 exons and spans approximately 22.2 kb . The cDNA of CYP4F3 contains 5050 nucleotides, excluding the poly(A) tail, and the translation initiation codon (ATG) is present in exon II .

Function and Metabolism

CYP4F3A and CYP4F3B play a crucial role in the omega oxidation of arachidonic acid to 20-hydroxyeicosatetraenoic acid (20-HETE) and epoxyeicosatrienoic acids (EETs) to 20-hydroxy-EETs . CYP4F3 is the major enzyme accomplishing omega oxidations in leukocytes . Leukotriene B4 (LTB4) omega-hydroxylase catalyzes the conversion of LTB4 into 20-hydroxy-LTB4, a biologically less active product .

Genetic Variants and Disease Associations

Single nucleotide variants (SNPs) in CYP4F3 have been associated with human diseases . The hydroxylation-induced inactivation of inflammatory mediators, particularly leukotriene B4, may underlie the roles of these cytochromes in dampening inflammatory responses . Specific SNPs, such as rs1290617 and rs1290620, have been associated with Crohn's disease, while rs1290622 and rs1290625 are linked to celiac disease . A missense mutation in CYP4F3 has been reported to affect the metabolism of leukotriene B4, leading to increased systemic LTB4 levels and features of inflammation .

Role in Inflammation and Immune Response

CYP4F3 is involved in metabolizing leukotriene B4 (LTB4), a chemoattractant for neutrophils and an essential component of the innate immune system . LTB4 is synthesized by leukocytes and is associated with immunological disorders such as asthma, arthritis, and inflammatory bowel disease .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CYP4F3; LTB4H; Cytochrome P450 4F3; 20-hydroxyeicosatetraenoic acid synthase; 20-HETE synthase; CYPIVF3; Cytochrome P450-LTB-omega; Docosahexaenoic acid omega-hydroxylase CYP4F3; Leukotriene-B(4 20-monooxygenase 2; Leukotriene-B(4 omega-hydroxylase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-520
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CYP4F3
Target Protein Sequence
MPQLSLSSLGLWPMAASPWLLLLLVGASWLLARILAWTYTFYDNCCRLRCFPQPPKRNWF LGHLGLIHSSEEGLLYTQSLACTFGDMCCWWVGPWHAIVRIFHPTYIKPVLFAPAAIVPK DKVFYSFLKPWLGDGLLLSAGEKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQL LASEGSARLDMFEHISLMTLDSLQKCVFSFDSHCQEKPSEYIAAILELSALVTKRHQQIL LYIDFLYYLTPDGQRFRRACRLVHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFID VLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQE LLKDREPKEIEWDDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDIVLPDGRVIPKGIIC LISVFGTHHNPAVWPDPEVYDPFRFDPKNIKERSPLAFIPFSAGPRNCIGQAFAMAEMKV VLGLTLLRFRVLPDHTEPRRKPELVLRAEGGLWLRVEPLS
Uniprot No.

Target Background

Function

Recombinant Human Leukotriene-B(4) omega-hydroxylase 2 (CYP4F3) is a cytochrome P450 monooxygenase involved in metabolizing various endogenous substrates, including fatty acids and their oxygenated derivatives (oxylipins). It utilizes molecular oxygen, inserting one oxygen atom into a substrate while reducing the second to water, using two electrons provided by NADPH via cytochrome P450 reductase (CPR). CYP4F3 may play a role in inactivating pro- and anti-inflammatory oxylipins during inflammation resolution. It predominantly catalyzes the omega-oxidation (oxidation of the terminal carbon) of oxylipins in myeloid cells, exhibiting high affinity for leukotriene B4 (LTB4). CYP4F3 inactivates LTB4 through three successive oxidative transformations to 20-hydroxy-LTB4, 20-oxo-LTB4, and finally 20-carboxy-LTB4. It also demonstrates omega-hydroxylase activity toward long-chain fatty acid epoxides, particularly 8,9-epoxy-(5Z,11Z,14Z)-eicosatrienoate (EET) and 9,10-epoxyoctadecanoate. Furthermore, CYP4F3 omega-hydroxylates monohydroxy polyunsaturated fatty acids (PUFAs), including HETEs and HEPEs, to dihydroxy compounds. It contributes to the degradation of saturated very long-chain fatty acids (VLCFAs), such as docosanoic acid, by catalyzing successive omega-oxidations to dicarboxylic acids, initiating chain shortening. It exhibits low hydroxylase activity toward PUFAs. Primarily, it catalyzes the omega-oxidation of PUFAs and participates in converting arachidonic acid to 20-hydroxyeicosatetraenoic acid (20-HETE), a vasoconstrictive and natriuretic signaling molecule influencing arterial blood pressure. It shows high omega-hydroxylase activity towards other PUFAs, including ETA, EPA, and DHA. It can also catalyze omega-1 oxidation (penultimate carbon oxidation) of PUFAs with lower efficiency. CYP4F3 contributes to VLCFA degradation (e.g., docosanoic and hexacosanoic acids) via successive omega-oxidations to dicarboxylic acids, initiating chain shortening. It omega-hydroxylates long-chain 3-hydroxy fatty acids, initiating their oxidative conversion to 3-hydroxydicarboxylic fatty acids. Finally, it displays omega-hydroxylase activity towards long-chain fatty acid epoxides, favoring EET and 9,10-epoxyoctadecanoate.

Gene References Into Functions
  1. High n-3:n-6 PUFA intake correlated with reduced ulcerative colitis (UC) risk in individuals with the GG/AG genotype at a CYP4F3 SNP, but not in those with the AA genotype. Dietary n-3:n-6 PUFA intake and UC risk may be modified by CYP4F3 variants. PMID: 28991856
  2. Functional SNPs in CYP4F3 (rs4646904) may contribute to lung cancer etiology, especially in smokers. PMID: 28150878
  3. Children with a higher omega-6/omega-3 dietary ratio were susceptible to Crohn's disease if carrying specific CYP4F3 and FADS2 gene variants. PMID: 24406470
  4. Review of the regulation and functional roles of human CYP4F3. PMID: 22706230
  5. CYP4F3 can directly stimulate RANKL-dependent osteoclast differentiation. PMID: 20047521
  6. Identification of distinct transcriptional features in myeloid, lymphoid, and hepatic cells suggests multiple promoters in the CYP4F3 gene. PMID: 12709424
  7. CYP4F3A appears responsible for LTB4 omega-hydroxylase activity. PMID: 14715252
  8. CYP4F18 is critical in regulating LTB4 metabolism. PMID: 16380383
  9. Description of the expression and function of CYP4F3A and its subfamily in human eosinophils. PMID: 17980168
  10. 3-hydroxystearate and 3-hydroxypalmitate are converted to omega-hydroxylated 3-OHDCA precursors in the liver; CYP4F11, and to a lesser extent CYP4F2, catalyzed omega-hydroxylation of 3-hydroxystearate; CYP4F3b, CYP4F12, and CYP4A11 showed negligible activity. PMID: 18065749
  11. CYP4F3B is the key enzyme producing 20-HETE via arachidonic acid omega-hydroxylation in liver cells. PMID: 18566475
  12. The main fatty acid pathway is the omega-hydroxylation of PUFAs. PMID: 18577768
  13. By regulating LTB4 balance in the lung, LTB4OH may suppress lung carcinogenesis. PMID: 19138970
Database Links

HGNC: 2646

OMIM: 601270

KEGG: hsa:4051

STRING: 9606.ENSP00000221307

UniGene: Hs.106242

Protein Families
Cytochrome P450 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Microsome membrane; Single-pass membrane protein.
Tissue Specificity
[Isoform CYP4F3A]: Selectively expressed in blood neutrophils and bone marrow cells. Coexpressed with CYP4F3B in prostate, ileum and trachea.; [Isoform CYP4F3B]: Selectively expressed in liver and kidney. It is also the predominant CYP4F isoform in trache

Q&A

What are the key structural characteristics of recombinant human CYP4F3?

Recombinant human neutrophil leukotriene B4 omega-hydroxylase (CYP4F3) has been successfully purified and characterized as a protein with an apparent molecular weight of 55 kDa, as determined by SDS-PAGE analysis. The enzyme demonstrates high specific content (14.8 nmol of P450/mg of protein) when purified from yeast expression systems . CYP4F3, like other cytochrome P450 enzymes, contains a heme group in its active site that is essential for its catalytic function.

The enzyme exists in two splice variants: CYP4F3A and CYP4F3B. These variants maintain identical size but differ in amino acids 67-114 due to the incorporation of different exons (exon 4 or exon 3, respectively). This structural difference has significant implications for their substrate specificity, with CYP4F3A demonstrating the highest affinity for pro-inflammatory LTB4 among all CYP4F isoforms .

How does CYP4F3 function biochemically in the metabolism of leukotriene B4?

CYP4F3 functions as an ω-hydroxylase that catalyzes the conversion of LTB4 to its inactive metabolite 20-hydroxy-leukotriene B4 (20OH-LTB4). The enzymatic mechanism involves several critical steps:

  • Binding of LTB4 to the substrate-binding site of CYP4F3A, inducing a conformational change

  • Facilitation of electron transfer from electron transfer partners (primarily POR) to the heme group

  • Oxygen activation and substrate hydroxylation

Kinetic studies reveal that purified recombinant CYP4F3 catalyzes the ω-hydroxylation of LTB4 with a Km of 0.64 μM and Vmax of 34 nmol/min/nmol of P450 when operating with rabbit hepatic NADPH-P450 reductase and cytochrome b5 . This catalytic process requires cofactor NADPH as an electron source, with electron transfer partners being essential for enzymatic oxidase activity .

What is the difference between CYP4F3A and CYP4F3B isoforms regarding tissue distribution and substrate specificity?

The two CYP4F3 isoforms exhibit distinct tissue distribution patterns and substrate preferences:

ParameterCYP4F3ACYP4F3B
Primary tissue expressionLeukocytesLiver and kidney
Exon incorporationExon 4Exon 3
Affinity for LTB4Highest among CYP4F isoforms30-fold lower than CYP4F3A
Primary substratesPro-inflammatory LTB4Arachidonic acid (AA) and ω3 PUFAs
Main functionω-hydroxylation of LTB4 to inactive 20OH-LTB4Metabolism of fatty acids

CYP4F3A's predominant expression in leukocytes aligns with its primary function in regulating inflammatory responses by inactivating LTB4. In contrast, CYP4F3B's expression in liver and kidney tissues reflects its broader role in fatty acid metabolism .

What techniques are most effective for expressing recombinant CYP4F3 in research settings?

For successful expression of recombinant CYP4F3, researchers have employed several effective systems:

  • Yeast expression systems: Have yielded high-quality purified enzyme with specific content of 14.8 nmol of P450/mg of protein, providing homogeneous protein as determined by SDS-PAGE .

  • Mammalian cell transfection: Researchers have successfully expressed CYP4F3A in HEK293T cells using plasmid transfection methods. The protocol typically involves:

    • Seeding HEK293T cells at 1 × 10^6 cells per plate

    • Transfecting with CYP4F3A wild-type or mutant plasmid using X-tremeGeneHP

    • Harvesting cells after 24 hours

    • Processing cells through homogenization in a medium containing 0.25 M sucrose, 5 mM MOPS (pH 7.2), and 1 mM EDTA (pH 7.2) with protease inhibitors

    • Cell disruption using a cold steel grinder (20 strokes)

    • Centrifugation separation (1500× g)

For researchers requiring purified enzyme for kinetic or structural studies, a multi-step chromatography approach is typically necessary. The purification process must maintain the protein's native conformation and catalytic activity, requiring careful consideration of buffer conditions and handling procedures.

How is CYP4F3 activity regulated at the molecular and cellular levels?

CYP4F3 activity regulation occurs through multiple mechanisms:

  • Protein-protein interactions: CYP4F3 requires electron transfer partners, particularly cytochrome P450 reductase (POR) and cytochrome b5 (Cytb5). These interactions are primarily mediated through electrostatic and hydrophobic contacts. The binding of POR to CYP4F3 involves complex formation via electrostatic interactions that facilitate electron transfer from the FMN domain of POR to the heme group of CYP4F3 .

  • Substrate binding: The binding of LTB4 into the substrate-binding site induces conformational changes that facilitate electron transfer from electron transfer partners to the heme group .

  • Post-translational modifications: Although not extensively characterized in the provided research, phosphorylation and other modifications likely influence CYP4F3 activity as they do with other cytochrome P450 enzymes.

  • Transcriptional regulation: Recent evidence suggests differential expression of CYP4F3 in certain pathological conditions, including significant upregulation in colorectal cancer tissues, indicating complex transcriptional regulation mechanisms .

What is the optimal methodology for measuring CYP4F3 enzymatic activity in experimental contexts?

The gold standard for measuring CYP4F3 enzymatic activity involves quantifying the conversion of LTB4 to 20-hydroxy-LTB4 using analytical techniques. A comprehensive methodology includes:

  • Sample preparation:

    • Isolation of the enzyme source (recombinant protein, microsomes, or whole cells)

    • Preparation of reaction mixture containing the enzyme, NADPH-regenerating system, and substrates

    • Incubation under controlled temperature and pH conditions

  • Analytical detection:

    • Capillary electrophoresis with ultraviolet detection has been successfully employed to detect LTB4 and its metabolites

    • HPLC or LC-MS/MS methods provide sensitive and specific quantification of metabolites

    • Instrument control and data analysis can be performed using systems such as 32 KaratTM software

  • Activity calculations:

    • Determination of kinetic parameters (Km, Vmax) using varying substrate concentrations

    • Calculation of specific activity (nmol/min/nmol of P450 or nmol/min/mg protein)

For comprehensive enzyme characterization, researchers should analyze activity across different substrate concentrations and compare wild-type to mutant variants to detect functional alterations, as demonstrated in studies of the L375V mutation .

How do mutations in CYP4F3 impact inflammatory disease pathology?

Mutations in CYP4F3 can significantly alter inflammatory disease pathology by disrupting the critical balance of pro-inflammatory mediators. A notable example is the L375V missense mutation (c.C1123 > G;p.L375V), which has been associated with a complex immune phenotype characterized by:

  • Biochemical consequences:

    • 50% reduction in CYP4F3 enzymatic activity (P < 0.0001)

    • Significantly elevated systemic LTB4 levels (1034.0 ± 75.9 pg/mL compared to 305.6 ± 57.0 pg/mL in healthy controls, P < 0.001)

  • Immunological impacts:

    • Altered B cell profiles with increased total CD19+ CD27− naive B cells (25%)

    • Decreased total CD19+ CD27+ IgD− switched memory B cells (19%)

    • Features of a more naive adaptive immune response

  • Clinical manifestations:

    • Exhaustion

    • Muscle weakness

    • Various inflammation-related conditions including gastritis, joint pain, and exercise-induced asthma

The mechanistic basis for this pathology stems from the mutation's location in the catalytic domain, specifically disrupting an α-helix crucial for electron shuffling between electron carriers and CYP4F3. Interestingly, the mutation does not affect protein stability or binding with electron donors (POR and Cytb5), as confirmed by co-immunoprecipitation studies (P > 0.9) .

What is the role of CYP4F3 in cancer development and progression?

Recent research has revealed a significant role for CYP4F3 in cancer development, particularly in colorectal cancer (CRC):

  • Expression patterns:

    • Upregulation of CYP4F3 in colorectal cancer tissues compared to normal tissues

    • Association between high CYP4F3 expression and poor patient prognosis

  • Functional impacts in cancer cells:

    • Promotion of cell proliferation and migration when overexpressed in CT26.wt and SW620 cells

    • Reduction of cellular oxidative stress

    • Upregulation of the oxidative stress-related NRF2 pathway

    • Inhibition of cellular ferroptosis (iron-dependent lipid peroxidation cell death)

  • Mechanistic pathway:

    • CYP4F3 inhibits NRF2-mediated ferroptosis, allowing cancer cells to escape this form of cell death

    • When NRF2 activity is inhibited, cellular ferroptosis is stimulated even in conditions of CYP4F3 overexpression

    • Administration of ferroptosis agonists to CYP4F3-overexpressing CRC cells activates NRF2 and reduces cell proliferation and migration

  • In vivo evidence:

    • Mice injected with CYP4F3-overexpressing CT26.wt cells developed significantly larger tumors compared to control groups

These findings identify CYP4F3 as a potential biomarker for CRC prognosis and highlight its significance as a therapeutic target, particularly through modulation of ferroptosis pathways.

How does CYP4F3 activity influence immune system function?

CYP4F3 exerts significant influence on immune system function primarily through its regulation of LTB4, a potent chemoattractant for neutrophils and an essential component of the innate immune system:

  • Innate immunity regulation:

    • By metabolizing LTB4 to its inactive form (20-OH-LTB4), CYP4F3A controls neutrophil recruitment and activation

    • Impaired CYP4F3 activity leads to elevated LTB4 levels, potentially causing dysregulated neutrophil responses and chronic inflammation

  • Adaptive immunity modulation:

    • Patients with CYP4F3 mutations show altered B cell profiles with increases in naive B cells and decreases in switched memory B cells

    • This suggests a role for CYP4F3 in B cell maturation and function, likely through indirect mechanisms involving inflammatory signaling pathways

  • Pathological implications:

    • The LTB4 pathway has been implicated in various immunological disorders including asthma, arthritis, and inflammatory bowel disease

    • CYP4F3 dysfunction may contribute to these conditions by failing to properly regulate inflammatory mediators

The complex interplay between CYP4F3 and immune function suggests potential therapeutic approaches targeting this pathway for inflammatory and immune-mediated diseases.

What are the optimal protocols for structural analysis of CYP4F3 and its variants?

Advanced structural analysis of CYP4F3 requires a multi-faceted approach combining computational and experimental techniques:

  • Homology modeling and in silico structure prediction:

    • Identification of suitable templates (e.g., cytochrome P450 crystal structure, pdb: 5T6Q) using Phyre2

    • Refinement through homology modeling suites such as MOE (Molecular Operating Environment)

    • Contact map creation using CMweb

    • Protein-protein docking of CYP4F3 with partners like cytochrome b5 using HADDOCK with interaction restraints

    • Identification of co-evolving residues using the EVfold (EVcouplings) server

  • Site-directed mutagenesis studies:

    • Introduction of specific mutations to analyze their impact on structure and function

    • Assessment of functional consequences through activity assays

    • Validation of structural predictions from computational models

  • Biophysical characterization techniques:

    • Circular dichroism spectroscopy to assess secondary structure

    • Thermal stability assays to evaluate structural integrity

    • Fluorescence-based binding assays to study substrate and cofactor interactions

  • Advanced microscopy and crystallography:

    • X-ray crystallography (challenging but valuable if achievable)

    • Cryo-electron microscopy for structural determination of CYP4F3 alone or in complex with binding partners

For studying disease-associated variants like L375V, researchers should combine structural analysis with functional assays to establish clear structure-function relationships. Computational modeling suggests that mutations like L375V disrupt an α-helix crucial for electron shuffling between electron carriers and CYP4F3, providing important insights into the molecular basis of enzyme dysfunction .

How can researchers effectively investigate CYP4F3-mediated pathways in disease models?

Investigating CYP4F3-mediated pathways in disease models requires a comprehensive experimental strategy:

  • In vitro cellular models:

    • Overexpression systems: Transfection of CYP4F3 variants in appropriate cell lines (e.g., HEK293T for basic studies, or disease-specific cell lines like SW620 for cancer studies)

    • CRISPR/Cas9 gene editing to create knockout, knockin, or site-specific mutants

    • Analysis of downstream effects using techniques such as RNA-seq, proteomics, and metabolomics

  • Ex vivo assays:

    • Whole blood assays to study LTB4 production and the effects of potential inhibitors

    • Analysis of patient-derived samples to correlate CYP4F3 function with disease parameters

    • Flow cytometry for immune phenotyping, as demonstrated in studies showing altered B cell profiles in patients with CYP4F3 mutations

  • In vivo disease models:

    • Development of transgenic mouse models expressing human CYP4F3 variants

    • Xenograft models, such as those used to demonstrate that CYP4F3-overexpressing CT26.wt cells form significantly larger tumors in mice

    • Disease-specific models (e.g., inflammation, cancer) to study CYP4F3's role in pathology

  • Pharmacological approaches:

    • Testing potential inhibitors or modulators of the LTB4 pathway (e.g., zileuton, which inhibits ex vivo LTB4 production to 2% of control levels, P < 0.0001)

    • Evaluation of specificity compared to other interventions (e.g., montelukast and fluticasone, which show no significant effects on LTB4 levels)

Integration of these approaches allows researchers to comprehensively characterize CYP4F3's role in disease pathogenesis and identify potential therapeutic interventions.

What advanced analytical techniques are most suitable for studying CYP4F3 substrates and metabolites?

Studying CYP4F3 substrates and metabolites requires sophisticated analytical approaches:

  • Chromatography-mass spectrometry techniques:

    • LC-MS/MS (liquid chromatography-tandem mass spectrometry) for sensitive and specific quantification of LTB4 and 20-OH-LTB4

    • UPLC (ultra-performance liquid chromatography) coupled with high-resolution mass spectrometry for metabolite profiling

    • GC-MS (gas chromatography-mass spectrometry) for analysis of fatty acid metabolites

  • Capillary electrophoresis approaches:

    • Capillary electrophoresis with ultraviolet detection has been effectively used to detect LTB4 and its metabolites

    • This technique offers high resolution separation with minimal sample requirements

    • Can be controlled using software such as 32 KaratTM (version 5.0, Beckman Coulter Instruments)

  • Metabolomic profiling:

    • Untargeted metabolomics to discover novel substrates or metabolites

    • Stable isotope labeling to track metabolic pathways and flux

    • Integration with transcriptomic and proteomic data for systems biology approaches

  • Enzyme kinetic studies:

    • Determination of kinetic parameters (Km, Vmax) for various substrates

    • Inhibition studies to characterize the binding site and develop selective inhibitors

    • Analysis of substrate specificity, as demonstrated in studies showing CYP4F3's capacity to metabolize various eicosanoids with differing affinities

A comprehensive analytical approach should include both targeted and untargeted methods to fully characterize the substrate profile and metabolic consequences of CYP4F3 activity in normal and disease states.

What are the main technical challenges in studying CYP4F3 function?

Researchers face several significant technical challenges when investigating CYP4F3:

  • Expression and purification difficulties:

    • Obtaining sufficient quantities of active, properly folded enzyme

    • Maintaining the native conformation during purification

    • Ensuring consistent activity between batches

  • Isoform-specific analysis:

    • Developing tools to distinguish between CYP4F3A and CYP4F3B isoforms

    • Creating isoform-selective antibodies or activity assays

    • Accounting for tissue-specific expression patterns in experimental design

  • Reconstitution of the complete enzyme system:

    • Recreating the complex interactions between CYP4F3 and its electron transfer partners (POR and Cytb5)

    • Establishing optimal ratios of enzyme to electron transfer partners

    • Modeling the impact of mutations on these protein-protein interactions

  • Translating in vitro findings to in vivo significance:

    • Developing appropriate animal models that recapitulate human CYP4F3 function

    • Accounting for species differences in enzyme activity and regulation

    • Correlating biochemical findings with clinical observations

Addressing these challenges requires interdisciplinary approaches combining molecular biology, biochemistry, structural biology, and clinical research methodologies.

How can researchers best approach the development of selective CYP4F3 modulators for therapeutic applications?

Development of selective CYP4F3 modulators requires a systematic approach:

  • Structure-based drug design:

    • Utilization of homology models and computational docking studies

    • Virtual screening of compound libraries against the CYP4F3 active site

    • Focusing on structural features that distinguish CYP4F3 from other CYP4F family members

  • High-throughput screening approaches:

    • Development of cell-based or biochemical assays suitable for screening compound libraries

    • Implementation of fluorescent or luminescent readouts for rapid detection

    • Counter-screening against related enzymes to ensure selectivity

  • Medicinal chemistry optimization:

    • Iterative improvement of lead compounds for potency, selectivity, and drug-like properties

    • Structure-activity relationship studies to identify key pharmacophore features

    • Assessment of metabolic stability and off-target effects

  • Therapeutic focus based on disease mechanism:

    • For inflammatory conditions: Targeting either CYP4F3 enhancement (to increase LTB4 metabolism) or upstream LTB4 synthesis (as demonstrated with zileuton, which inhibits ex vivo LTB4 production)

    • For cancer applications: Developing approaches that modulate CYP4F3's influence on ferroptosis pathways

  • Validation in relevant disease models:

    • Testing candidate modulators in cellular and animal models of disease

    • Evaluating impacts on specific endpoints (LTB4 levels, inflammatory markers, tumor growth)

    • Assessing potential synergy with existing therapeutic approaches

This multifaceted strategy can help overcome the challenges of developing selective modulators for a specific cytochrome P450 enzyme.

What are the most promising research directions for understanding CYP4F3's broader role in human pathophysiology?

Several promising research directions are emerging for understanding CYP4F3's broader role:

  • Expanded disease association studies:

    • Investigation of CYP4F3 variants in larger patient cohorts with inflammatory and immune-mediated diseases

    • Genome-wide association studies to identify additional CYP4F3 mutations

    • Correlation of enzyme activity with disease severity and progression

  • Systems biology approaches:

    • Integration of transcriptomic, proteomic, and metabolomic data to place CYP4F3 in broader biological networks

    • Computational modeling of inflammatory pathways incorporating CYP4F3 activity

    • Analysis of feedback mechanisms regulating the LTB4 pathway

  • Role in novel cellular processes:

    • Further investigation of CYP4F3's role in ferroptosis and oxidative stress pathways

    • Exploration of potential functions beyond LTB4 metabolism

    • Assessment of interactions with other cellular stress response mechanisms

  • Therapeutic targeting strategies:

    • Development of isoform-specific modulators

    • Evaluation of combination therapies targeting multiple points in the LTB4 pathway

    • Investigation of tissue-specific delivery approaches

  • Translational research:

    • Biomarker development using CYP4F3 activity or expression

    • Clinical trials of pathway modulators in inflammatory diseases

    • Personalized medicine approaches based on CYP4F3 genotype or activity profiles

The recent discovery of CYP4F3's role in colorectal cancer via inhibition of NRF2-mediated ferroptosis exemplifies how continued research can reveal unexpected functions with significant therapeutic implications. Future studies integrating these diverse approaches will likely uncover additional roles for this enzyme in human health and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.