Recombinant Human Leukotriene B4 receptor 2 (LTB4R2)

Shipped with Ice Packs
In Stock

Description

Ligand Specificity and Signaling

  • Primary ligands: Binds leukotriene B4 (LTB4) with low affinity (Kd ~23 nM) and 12-hydroxyheptadecatrienoic acid (12-HHT) with high affinity (Kd ~0.3 nM) .

  • Downstream pathways: Activates Gαi and Gαq proteins, triggering calcium flux, ERK, Akt, JNK, NF-κB, and NADPH oxidase (NOX)-mediated reactive oxygen species (ROS) .

Biological Functions

  • Anti-inflammatory: Mediates resolution of colitis by enhancing epithelial barrier integrity and suppressing pro-inflammatory cytokines (e.g., IL-6, IFN-γ) .

  • Pro-migratory: Drives macrophage chemotaxis during tissue injury and inflammation .

  • Cancer progression: Promotes epithelial-mesenchymal transition (EMT), anoikis resistance, and metastasis in breast and prostate cancers .

Research Applications

Recombinant LTB4R2 is utilized in:

  1. Ligand-binding assays to study receptor-ligand interactions (e.g., 12-HHT vs. LTB4) .

  2. Cell migration studies using transwell systems to assess macrophage or cancer cell chemotaxis .

  3. Therapeutic target validation in inflammatory diseases (e.g., ulcerative colitis) and cancer .

Inflammatory Diseases

  • Colitis: BLT2-knockout mice exhibit exacerbated colon inflammation, impaired barrier function, and elevated STAT3 activation .

  • Lung injury: BLT2 protects against pneumolysin-induced lung epithelial damage by enhancing tight junction proteins (e.g., claudin-4) .

Cancer

  • Breast cancer: Overexpression of hLFBLT2 increases TGF-β-induced EMT and invasiveness via NOX1/ROS/NF-κB signaling .

  • Prostate cancer: BLT2 activation suppresses anoikis by upregulating Bcl-2 and downregulating Bax/Bad .

Clinical and Therapeutic Implications

  • Anti-inflammatory therapies: Targeting BLT2 with agonists (e.g., 12-HHT analogs) may treat colitis or asthma .

  • Cancer therapeutics: BLT2 antagonists (e.g., LY255283) are under investigation to block metastasis .

Future Directions

  • Mechanistic studies: Elucidate isoform-specific signaling in vivo.

  • Drug development: Optimize BLT2 modulators for clinical trials in inflammation and oncology.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance for arrangements and associated charges.
Notes
Avoid repeated freezing and thawing. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
LTB4R2; BLT2R; BLTR2; Leukotriene B4 receptor 2; LTB4-R 2; LTB4-R2; LTB4 receptor JULF2; Leukotriene B4 receptor BLT2; Seven transmembrane receptor BLTR2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-389
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MAPSHRASQVGFCPTPERPLWRLPPTCRPRRMSVCYRPPGNETLLSWKTSRATGTAFLLL AALLGLPGNGFVVWSLAGWRPARGRPLAATLVLHLALADGAVLLLTPLFVAFLTRQAWPL GQAGCKAVYYVCALSMYASVLLTGLLSLQRCLAVTRPFLAPRLRSPALARRLLLAVWLAA LLLAVPAAVYRHLWRDRVCQLCHPSPVHAAAHLSLETLTAFVLPFGLMLGCYSVTLARLR GARWGSGRHGARVGRLVSAIVLAFGLLWAPYHAVNLLQAVAALAPPEGALAKLGGAGQAA RAGTTALAFFSSSVNPVLYVFTAGDLLPRAGPRFLTRLFEGSGEARGGGRSREGTMELRT TPQLKVVGQGRGNGDPGGGMEKDGPEWDL
Uniprot No.

Target Background

Function
Leukotriene B4 receptor 2 (BLT2) is a low-affinity receptor for leukotrienes, including leukotriene B4. It plays a crucial role in mediating chemotaxis of granulocytes and macrophages. This response is initiated through G-proteins that activate a phosphatidylinositol-calcium second messenger system. The affinity for leukotrienes follows this rank order: LTB4 > 12-epi-LTB4 > LTB5 > LTB3.
Gene References Into Functions
  1. In a cohort of 545 breast cancer patients with metastasis, researchers observed a lower disease-free-survival rate in the high-BLT2 subgroup compared to the low-BLT2 subgroup. PMID: 29898809
  2. BLT2 gene polymorphism (D196G) enhances ligand sensitivity, leading to increased cell motility in response to low-dose ligand stimulation. PMID: 29170475
  3. Leukotriene B4 receptor type 2 (BLT2) offers protection against pneumolysin-dependent acute lung injury. PMID: 27703200
  4. BLT2 ligation facilitates F-actin assembly through the upregulated phosphorylation of MYPT1. PMID: 26896822
  5. Supernatants and lipids from stored red blood cells activate pulmonary microvascular endothelium via the BLT2 receptor. PMID: 28880373
  6. RanBPM acts as a negative regulator of BLT2 and IL8, thereby attenuating the invasiveness of aggressive breast cancer cells. PMID: 28027932
  7. BLT2 inhibition induces apoptosis, inhibits proliferation, colony formation, and self-renewal capacity in CD34(+) cells from tyrosine kinase inhibitor-resistant blast phase-chronic myeloid leukemia patients. PMID: 26966074
  8. Data suggests that signal transducer and activator of transcription-3 (STAT-3) activation occurs downstream of leukotriene B4 receptor-2 (BLT2) and mediates cisplatin resistance in SK-OV-3 cells. PMID: 26597704
  9. Researchers demonstrated that MyD88 lies upstream of BLT2 in LPS-potentiated invasiveness. This 'MyD88-BLT2' cascade mediates activation of NF-kappaB and the synthesis of IL-6 and IL-8, critical for the invasiveness and aggression of breast cancer cells. PMID: 25691060
  10. BLT1 and BLT2 represent potential targets for the development of novel drugs. PMID: 25480980
  11. Researchers investigated BLT2 downstream components and identified reactive oxygen species and nuclear factor kappaB as critical elements that contribute to epithelial-mesenchymal transition in mammary epithelial cells. PMID: 24990945
  12. The BLT2-NOX-ROS-NF-kappaB cascade induction during detachment confers a novel mechanism of anoikis resistance in prostate cancer cells and potentially contributes to prostate cancer progression. PMID: 23986446
  13. RanBPM acts as a negative regulator of BLT2 signaling to attenuate BLT2-mediated cell motility. PMID: 23928309
  14. Findings suggest that BLT2 plays a protective role in allergic airway inflammation, and diminished BLT2 expression in CD4(+) T cells may contribute to the pathophysiology of asthma. PMID: 23603839
  15. BLT2 is a novel therapeutic target that sensitises drug-resistant breast cancer cells to paclitaxel. PMID: 23799854
  16. Research indicates that, in bronchial epithelial cells, cigarette smoke extracts (CSE) promote induction of pro-inflammatory BLT2 receptors and activate mechanisms leading to increased neutrophil adhesion. PMID: 23347335
  17. A study demonstrates that BLT2 upregulates IL-8 production, thus contributing to the invasiveness of aggressive breast cancer cells. PMID: 23145117
  18. LTB4R2 exhibits splice variation in the 5'-untranslated region and multiple promoter regions. LTB4R2 polymorphisms do not appear to be susceptibility markers for the development of asthma in Caucasian subjects. PMID: 23167751
  19. The results indicate that LTB4 receptors BLT1 and BLT2 are involved in IL-8 production and secretion by human neutrophils induced by T. vaginalis. PMID: 22215047
  20. Leukotriene B4 receptor-2 (BLT2) promotes invasiveness and metastasis of ovarian cancer cells through signal transducer and activator of transcription 3 (STAT3)-dependent up-regulation of matrix metalloproteinase 2. PMID: 22396544
  21. These findings point to BLT2 as a key regulator of AR expression and will contribute to the development of novel therapies for AR-positive prostate cancers, including androgen-responsive and castration-resistant prostate cancers. PMID: 22426480
  22. BLT2 phosphorylation at Thr355 by Akt is necessary for BLT2-mediated chemotaxis. PMID: 22044535
  23. Up-regulation of BLT2 is associated with bladder cancer. PMID: 21252614
  24. The BLT2-Nox1-reactive oxygen species-dependent pathway plays a role in promoting the secretion of IL-8 from human mast cells in response to the proinflammatory cytokine IL-1beta, thus contributing to angiogenesis. PMID: 20194723
  25. A 'BLT2-Nox1'-linked pathway has a crucial role in UVB-induced ROS generation and mediates apoptosis in human keratinocytes. PMID: 20090768
  26. The 'BLT2-Nox1-ROS'-linked cascade is involved in the pro-survival signaling, particularly in ER-negative breast cancer cells. PMID: 19748928
  27. BLT2 stimulates the purified G alpha(i2) beta(1) gamma(2) protein more efficiently than the dimer; assembly of two BLT2 protomers into a dimer results in reduced signaling capacity. PMID: 20026606
  28. BLT2 plays a pivotal, mediatory role in the pathogenesis of asthma, acting through a 'reactive oxygen species-NF-kappaB'-linked inflammatory signaling pathway. PMID: 19448154
  29. BLT2 is a low-affinity leukotriene B4 receptor; its 358 amino acid sequence shares 92.7% identity with the mouse receptor. PMID: 12895595
  30. BLT2 (the low-affinity receptor for LTB4) exhibited stronger expression than BLT1 (the high-affinity receptor) in actively inflamed synovial tissue from patients with rheumatoid arthritis. PMID: 12913925
  31. The LTB4-BLT2-linked cascade plays a crucial mediatory role in cell transformation induced by oncogenic Ha-Ras(V12), potentially acting downstream of Rac-cPLA2. PMID: 15489890
  32. Data suggests that functional leukotriene B4 receptors (BLT1 and 2) may be expressed on the surface of endothelial cells in response to lipopolysaccharides, cytokines, and LTB4. PMID: 16624877
  33. Research demonstrates expression of functional Leukotriene B4 receptors, both BLT1 and BLT2, in murine and human mast cells, and a regulatory role for stem cell factor in their expression. PMID: 16920986
  34. The BLT2-Nox1-linked cascade is responsible for the elevated ROS generation in Ras-transformed cells. PMID: 18082638
  35. Genetic variation in leukotriene pathway members and their receptors confers an increased risk of ischemic stroke in 2 independent populations. PMID: 18323512
  36. BLT2 was expressed in 45% of ovarian neoplasms and correlated with advanced stage III/IV disease, suboptimal debulking, and platinum resistance. PMID: 18421027
  37. Upregulation of BLT2 is evident in precursor lesions (PanINs, IPMNs). Overexpression of this receptor leads to significant growth stimulation. PMID: 18781173
  38. LTB4 phosphorylates MAPKs and stimulates NF-kappaB-dependent inflammation via BLT1 and BLT2 receptors in cultured monocytic cells. Blockade of this pathway could be a novel and potential therapeutic target in atherothrombosis. PMID: 18852255
  39. The response of the pleural mesothelium to LTB4 results from a balance between the activation of LTB4 receptors with proinflammatory outcomes (BLT2) and the activation of a different LTB4 receptor with anti-inflammatory outcomes (PPAR). PMID: 18981151
  40. Results suggest that the helix 8 region of hBLT2 plays an important role in transport-competent receptor folding. PMID: 19126593
  41. Findings indicate that BLT2 plays an essential role in mediating VEGF-induced angiogenesis. PMID: 19286633

Show More

Hide All

Database Links

HGNC: 19260

OMIM: 605773

KEGG: hsa:56413

STRING: 9606.ENSP00000433290

UniGene: Hs.642693

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed.

Q&A

What is the structural and functional relationship between LTB4R2 (BLT2) and LTB4R1 (BLT1)?

BLT2 shares 45.2% amino acid identity with BLT1, with high similarity particularly in the transmembrane domains TM-2, TM-3, and TM-7. Despite this structural similarity, BLT2 has distinct ligand binding properties and tissue distribution. The two receptors belong to the G protein-coupled receptor superfamily and their genes form a cluster on human and mouse chromosome 14. Interestingly, the BLT2 open reading frame is located in the promoter region of the BLT1 gene, suggesting shared transcriptional regulation .

The functional relationship between these receptors is complex - they mediate some similar cellular responses but can also have opposing roles in inflammation and allergic responses. While both bind LTB4, BLT2 binds it with much lower affinity (Kd value of 23 nM compared to 1.1 nM for BLT1) . This fundamental difference in binding affinity contributes to their distinct physiological roles.

What are the primary ligands for BLT2 and how do they compare to BLT1 ligands?

BLT2 recognizes several arachidonic acid metabolites with varying affinities. While initially identified as a low-affinity receptor for LTB4, subsequent research revealed that 12-hydroxyheptadecatrienoic acid (12-HHT) has 10-100 fold higher affinity for BLT2 than does LTB4 . Importantly, 12-HHT fails to bind or activate BLT1 receptors, making it a relatively selective BLT2 agonist .

When studying ligand interactions, researchers should consider that BLT2 antagonists have different profiles than BLT1 antagonists. For example, U 75302, which inhibits LTB4 binding to BLT1, fails to inhibit LTB4 binding to BLT2 . This pharmacological distinction is crucial when designing experiments to selectively target either receptor.

A comprehensive binding assay comparing multiple eicosanoids against both receptors would typically include:

LigandBLT1 Kd (nM)BLT2 Kd (nM)Selectivity Ratio
LTB41.12320.9 (BLT1)
12-HHTNo binding~2-3BLT2 selective
Other arachidonic acid metabolitesVariableVariableVariable

How is BLT2 expressed across different tissues and cell types?

Unlike BLT1, which is predominantly expressed in leukocytes, BLT2 exhibits ubiquitous expression across multiple tissues . This wide distribution suggests that BLT2 mediates cellular functions beyond the immune system, potentially explaining its diverse roles in both physiological and pathological conditions.

Researchers investigating BLT2 expression should consider both transcriptional and translational analyses across diverse tissues. BLT2 expression has been detected in bone marrow-derived and peritoneal macrophages of mouse models, suggesting important roles in the immune response . When studying expression patterns, it's important to use specific antibodies that can differentiate between BLT1 and BLT2 due to their structural similarities.

What signaling pathways are activated downstream of BLT2?

BLT2 activation triggers multiple intracellular signaling cascades. In Chinese hamster ovary cells expressing BLT2, LTB4 stimulation leads to chemotaxis, calcium mobilization, and pertussis toxin-insensitive inhibition of adenylyl cyclase . These signaling pathways contribute to various cellular responses, including cell migration and inflammatory mediator production.

When studying BLT2 signaling, researchers should incorporate both calcium flux assays and chemotaxis experiments. Additionally, measuring adenylyl cyclase activity provides insight into the G protein coupling of the receptor. The distinct pertussis toxin sensitivity profile compared to BLT1 signaling can be used to differentiate between the two receptors in experimental settings.

How does BLT2 regulate macrophage function during inflammation?

Recent studies using zebrafish and mouse models have revealed crucial roles for BLT2 in macrophage migration during inflammation. While BLT2 deficiency doesn't affect macrophage polarization into pro-inflammatory (M1) or anti-inflammatory (M2) states, it significantly impairs macrophage migration .

In mouse models, peritoneal macrophages isolated from Ltb4r2−/− mice showed significantly reduced migration through transwell membranes compared to wild-type macrophages . Similarly, in zebrafish models, morpholino-mediated knockdown of ltb4r2a or treatment with the BLT2 antagonist LY255283 resulted in reduced macrophage recruitment to tailfin injury sites .

To study BLT2's role in macrophage migration, researchers can employ both in vitro transwell migration assays and in vivo inflammation models. For in vivo studies, LPS-induced peritonitis in Ltb4r2−/− mice showed significantly lower numbers of peritoneal macrophages compared to wild-type mice, confirming BLT2's importance in macrophage recruitment during inflammation .

What structural approaches have been used to characterize the BLT2-ligand interaction?

NMR spectroscopy has been successfully employed to determine the structure of the agonist 12-HHT in its BLT2-bound state . This structural data, combined with conformational homology modeling and docking simulations, has provided insights into the ligand-receptor interaction and helped explain ligand selectivity .

For researchers interested in structural studies of BLT2, the following methodological approaches are recommended:

  • NMR spectroscopy for ligand structure determination

  • Homology modeling based on crystal structures of related GPCRs

  • Molecular docking simulations to predict ligand-receptor interactions

  • Site-directed mutagenesis to confirm the importance of specific residues in ligand binding

These structural insights are particularly valuable for drug discovery efforts targeting BLT2, as they illuminate the molecular basis for ligand selectivity between BLT1 and BLT2.

How can researchers effectively express and purify recombinant human BLT2?

Several expression systems have been successfully used to produce functional BLT2 for research purposes. For example, Chinese hamster ovary (CHO) cells have been used to stably express HA-tagged BLT2 . The following methodology has proven effective:

  • Construction of expression vectors:

    • Amplify BLT2 inserts from genomic clones using PCR

    • Subclone into appropriate expression vectors (e.g., pcDNA3)

    • Include epitope tags (e.g., HA-tag) for easier detection and purification

  • Transfection and selection:

    • Transfect cells using lipofection (e.g., with Transfectam)

    • Select stable clones using G418 (1 mg/ml)

    • Isolate resistant clones by limiting dilution

  • Verification of expression:

    • Confirm expression using antibodies against epitope tags

    • Verify receptor functionality through binding assays with radiolabeled ligands

    • Assess downstream signaling using calcium mobilization or chemotaxis assays

For membrane preparation, cells expressing BLT2 can be harvested, homogenized, and centrifuged to obtain membrane fractions for binding assays, with protein concentrations determined by Bradford assay .

What are the most effective assays for characterizing BLT2 function?

When studying BLT2 function, researchers should consider multiple complementary assays:

  • Ligand binding assays:

    • Competitive binding using radiolabeled ligands (e.g., [³H]-LTB4)

    • Saturation binding to determine affinity constants (Kd values)

    • Displacement studies with various potential ligands

  • Signaling assays:

    • Calcium mobilization assays to measure intracellular calcium flux

    • cAMP assays to assess adenylyl cyclase inhibition

    • ERK phosphorylation to evaluate MAPK pathway activation

  • Functional assays:

    • Chemotaxis assays using Boyden chambers or transwell systems

    • Migration assays in scratched cell monolayers

    • Cell proliferation and survival assays

  • In vivo models:

    • LPS-induced peritonitis to assess macrophage recruitment

    • Tailfin injury in zebrafish to evaluate inflammatory responses

    • Disease-specific models (e.g., cancer xenografts)

Each of these assays provides unique insights into BLT2 biology and should be selected based on the specific research question being addressed.

How can researchers distinguish between BLT1 and BLT2 responses in experimental settings?

  • Selective ligands:

    • Use 12-HHT as a BLT2-selective agonist (10-100 fold higher affinity for BLT2 than LTB4)

    • Utilize specific antagonists (U 75302 inhibits BLT1 but not BLT2)

  • Genetic approaches:

    • Use knockout models (Ltb4r2−/− mice)

    • Apply targeted siRNA or morpholinos (as demonstrated in zebrafish models)

    • Employ CRISPR-Cas9 for targeted receptor deletion

  • Expression systems:

    • Use cell lines that express only one receptor type

    • Create systems with differential expression of fluorescently tagged receptors

  • Tissue selection:

    • Focus on tissues with predominant expression of one receptor (leukocytes for BLT1, other tissues for BLT2)

By combining these approaches, researchers can more confidently attribute observed effects to either BLT1 or BLT2 activation.

How can researchers address non-specific binding in BLT2 receptor assays?

Non-specific binding can significantly complicate the interpretation of BLT2 binding studies. To minimize this issue:

  • Include appropriate controls:

    • Perform binding assays in the presence of excess unlabeled ligand to determine non-specific binding

    • Use cells not expressing BLT2 as negative controls

  • Optimize assay conditions:

    • Adjust buffer compositions to reduce non-specific interactions

    • Optimize protein concentrations in membrane preparations

    • Carefully select incubation times and temperatures

  • Consider alternative detection methods:

    • Use fluorescent ligands instead of radioactive ones if non-specific binding is problematic

    • Employ proximity-based assays (e.g., BRET, FRET) to increase specificity

  • Validate with multiple approaches:

    • Confirm binding results with functional assays

    • Use both overexpression and knockout systems to verify specificity

What strategies help overcome difficulties in generating stable BLT2 expression systems?

G protein-coupled receptors like BLT2 can be challenging to express stably at high levels. The following strategies can help overcome these difficulties:

  • Optimize codon usage for the host expression system

  • Include an N-terminal signal sequence to enhance membrane targeting

  • Add epitope tags (e.g., HA-tag) to monitor expression levels

  • Use inducible expression systems to control expression timing

  • Consider fusion partners that enhance folding and trafficking

  • Employ cell lines specifically designed for GPCR expression

  • Screen multiple clones to identify high expressors

  • Optimize selection conditions and culture media

These approaches can significantly improve the yield and functionality of recombinant BLT2 in heterologous expression systems.

What are the therapeutic implications of targeting BLT2 in inflammatory diseases?

BLT2 represents a promising therapeutic target for inflammatory conditions, particularly given its distinct role in macrophage migration during inflammation . Unlike BLT1, which has been extensively studied as a target, BLT2's ubiquitous expression and unique signaling properties offer potential advantages for therapeutic intervention.

Future drug discovery efforts might focus on:

  • Developing highly selective BLT2 antagonists

  • Creating biased ligands that activate specific signaling pathways downstream of BLT2

  • Exploring combination therapies targeting both BLT1 and BLT2

  • Investigating tissue-specific delivery strategies to target BLT2 in specific inflammatory contexts

How might advances in structural biology enhance our understanding of BLT2?

Recent structural studies, including NMR determination of the 12-HHT structure in its BLT2-bound state, have provided valuable insights into BLT2-ligand interactions . Future structural biology approaches could significantly advance BLT2 research:

  • Full-length crystal or cryo-EM structures of BLT2 in complex with various ligands

  • Structural characterization of BLT2 in different activation states

  • Analysis of BLT2 interactions with intracellular signaling partners

  • Comparative structural studies of BLT1 and BLT2 to explain their distinct pharmacological profiles

These structural insights would not only enhance our fundamental understanding of BLT2 biology but also facilitate structure-based drug design targeting this receptor.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.