Recombinant Human Linker for activation of T-cells family member 1 (LAT)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
LAT; Linker for activation of T-cells family member 1; 36 kDa phospho-tyrosine adapter protein; pp36; p36-38
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-262
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
LAT
Target Protein Sequence
MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEGASGIRGAQAGWGVWGPSWTRLTPVSLPPEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN
Uniprot No.

Target Background

Function
Recombinant Human Linker for activation of T-cells family member 1 (LAT) is essential for TCR (T-cell antigen receptor) and pre-TCR mediated signaling in both mature T cells and during their development. It plays a role in FCGR3 (low affinity immunoglobulin gamma Fc region receptor III)-mediated signaling in natural killer cells and FCER1 (high affinity immunoglobulin epsilon receptor)-mediated signaling in mast cells. LAT couples the activation of these receptors and their associated kinases to downstream intracellular events, including mobilization of intracellular calcium stores, PKC activation, MAPK activation, and cytoskeletal reorganization. This is achieved through the recruitment of signaling molecules such as PLCG1, GRB2, and GRAP2.
Gene References Into Functions
References:
  1. Plasma membrane LAT activation precedes vesicular recruitment, defining two phases of early T-cell activation. PMID: 29789604
  2. LAT1 overexpression is a negative prognostic marker linked to tumor grade, proliferative potential, angiogenesis, and intracellular anticancer agent transport. PMID: 28815339
  3. Cooperative GRB2 family binding to LAT may enhance antigen receptor sensitivity by prioritizing complete signalosome formation. PMID: 28951535
  4. Nur77 suppresses CD4(+) T cell proliferation, and Irf4 plays a suppressive role in TH2 polarization. PMID: 28538176
  5. SHP-1-mediated LAT and phospholipase C-gamma dephosphorylation inhibits natural killer cell cytotoxicity. PMID: 27221712
  6. Single-molecule tracking reveals a subdiffusive motion of LAT:Grb2:SOS assemblies, indicating a loosely entangled polymer structure. PMID: 29045874
  7. Phosphotyrosine-mediated assembly of LAT networks generates two distinct kinetic species of the Ras activator SOS. PMID: 27370798
  8. LAT overexpression is associated with microcephaly. PMID: 28965845
  9. LAT and SLP-76 are randomly dispersed in clusters formed upon TCR engagement. PMID: 27875277
  10. Inherited LAT deficiency should be considered in patients with combined immunodeficiency and T-cell abnormalities. PMID: 27522155
  11. LAT-related disease manifests as progressive combined immunodeficiency with severe autoimmune disease. PMID: 27242165
  12. LAT1 plays a role in regulating leucine uptake in endometrial cancer cells. PMID: 27486861
  13. The TSAd SH2 domain interacts with CD6 antigen and LAT phosphotyrosine peptides. PMID: 27896837
  14. High LAT1 and ASCT2 expression correlates with metastasis and invasion in esophageal squamous cell carcinoma. PMID: 26936531
  15. IFT20 is required for LAT delivery to the immune synapse in naive T lymphocytes. PMID: 26715756
  16. LAT palmitoylation mutation attenuates CD59-induced signal transduction in T cells. PMID: 26271970
  17. HSV-1 Us3 inactivates LAT, interrupting TCR signaling and IL-2 production. PMID: 25907557
  18. Patients with severe aplastic anemia show increased LAT levels and disturbed Th1-Th2 balance. PMID: 24673455
  19. LAT modulates CD3zeta and ZAP-70 tyrosine phosphorylation. PMID: 24204825
  20. LAT palmitoylation site mutation attenuates CD59 signal transduction in T cells. PMID: 24200054
  21. LAT1 is a major transporter for essential amino acids into activated human T cells. PMID: 24038088
  22. Histone hypoacetylation on the LAT promoter inhibits LAT expression and enhances Th2 differentiation. PMID: 23360572
  23. LAT maintains calcium homeostasis in T cells. PMID: 22998346
  24. TRAF6 acts in the TCR-LAT signaling pathway; LAT has an adapter role in TCR/CD28-induced TRAF6 activation. PMID: 23514740
  25. Surface LAT is recruited to activation-induced microclusters upon TCR engagement. PMID: 23487428
  26. LAT cleavage regulates TCR-mediated T-cell activation. PMID: 23240581
  27. Constitutively active Raf enhances lymphoproliferation, suggesting a role for the Ras-MAPK pathway in LAT-mediated autoimmunity. PMID: 22984075
  28. Nef disturbs early TCR signaling by limiting LAT-SLP-76 communication. PMID: 22802418
  29. Modeling of LAT aggregation with variable Grb2-SOS1-Grb2 binding sites. PMID: 22396725
  30. LAT residues 112-126 are required for Lck interaction. PMID: 22034845
  31. TCR activation recruits and phosphorylates LAT from subsynaptic vesicles; recruitment precedes phosphorylation. PMID: 21642986
  32. MAL regulates membrane order and protein sorting of Lck and LAT to the cSMAC. PMID: 21508261
  33. PECAM-1 inhibits GPVI-dependent platelet responses by recruiting SHP-2-p85 complexes, diminishing PI3K association with Gab1 and LAT. PMID: 20723025
  34. LAT recruits SLP-76, activating the PI3K cascade. PMID: 21282515
  35. Elevated LAT1 expression is associated with lung squamous cell carcinoma. PMID: 19068093
  36. LAT promotes TCR signal initiation and maintains active Lck proximity to substrates. PMID: 21152094
  37. LAT ubiquitylation attenuates T-cell signaling. PMID: 21282648
  38. HSP90 positively regulates LAT gene expression in activated T cells. PMID: 21251717
  39. LAT serine-based motifs are essential for TCR signal transduction. PMID: 20940326
  40. LAT is in membrane rafts and involved in signaling through various receptors. PMID: 20875087
  41. Decreased LAT mRNA expression in asthmatic patients' T cells may be due to Lck and ZAP-70 upregulation. PMID: 18683785
  42. PUFAs inhibit T cell signaling by displacing LAT from lipid rafts. PMID: 12029091
  43. Itk phosphorylates LAT, promoting Vav recruitment. PMID: 12186560
  44. LAT is involved in T cell activation signal transduction and is associated with plasma membrane rafts. PMID: 12515827
  45. Interaction with open-active Lck in lipid rafts regulates Lck in T cells. PMID: 12570875
  46. Synergistic assembly in T cell plasma membrane domains. PMID: 12646565
  47. LAT is required for correct microtubule-organizing center orientation during T cell-APC interaction. PMID: 12847255
  48. Basis for Gads preferential recognition of specific LAT sites. PMID: 15029250
  49. CD3/TCR signaling to beta 1 integrins is defective in LAT-deficient cells and restored by wild-type LAT. PMID: 15100278
  50. LAB resembles a LAT molecule unable to bind phospholipase C-gamma1. PMID: 15153499
Database Links

HGNC: 18874

OMIM: 602354

KEGG: hsa:27040

UniGene: Hs.632179

Involvement In Disease
Immunodeficiency 52 (IMD52)
Subcellular Location
Cell membrane; Single-pass type III membrane protein. Note=Present in lipid rafts.
Tissue Specificity
Expressed in thymus, T-cells, NK cells, mast cells and, at lower levels, in spleen. Present in T-cells but not B-cells (at protein level).

Q&A

What is the Linker for Activation of T cells (LAT) and what is its primary function?

LAT is a transmembrane protein encoded by the LAT gene, which plays a crucial role in the diversification of T cell signaling pathways following activation of the T-cell antigen receptor (TCR) signal transduction pathway. The protein localizes to lipid rafts (also known as glycosphingolipid-enriched microdomains or GEMs) and functions as a docking site for SH2 domain-containing proteins. Upon phosphorylation, LAT recruits multiple adaptor proteins and downstream signaling molecules into multimolecular signaling complexes located near the site of TCR engagement . This orchestration of signaling molecules is essential for proper T cell development and function, as evidenced by studies showing that a lack of functional LAT leads to complete absence of T cell development in mouse thymocytes .

How is LAT involved in the TCR signaling pathway?

The TCR signaling pathway begins when a T-cell receptor interacts with peptide-bound MHC, leading to the activation of LCK and Fyn kinases, which are members of the Src family. Activated LCK phosphorylates the immunoreceptor tyrosine-based activation motifs (ITAMs) of the T-cell surface glycoprotein CD3 zeta chain in two specific locations. These phosphorylated ITAMs enable ZAP-70, a Syk family protein tyrosine kinase, to bind, become activated, and subsequently phosphorylate LAT . Once phosphorylated, LAT serves as a platform for recruiting various signaling molecules, initiating downstream signaling cascades that ultimately lead to T cell activation, proliferation, and effector functions .

Which protein interactions are critical for LAT function in T cell signaling?

LAT interacts with several key proteins through its phosphorylated tyrosine residues. The three most critical binding partners are:

  • Grb2: A small adaptor protein that binds to LAT via specific tyrosine residues (particularly Y171, Y191, and Y226) and links LAT to the Ras-MAPK pathway .

  • Gads: A Grb2-related adapter protein that associates with LAT, showing preference for different sets of tyrosine residues than Grb2 .

  • PLC-γ1: Phospholipase C-gamma 1 binds to LAT primarily through Y132 and is critical for calcium mobilization in T cells .

Research demonstrates that these interactions are not redundant but complementary, as mutation studies show that disrupting specific binding sites affects different downstream pathways .

What is the minimal tyrosine residue requirement for LAT function in T cell activation?

Experimental evidence indicates that a minimum of three tyrosine residues is required for LAT to function effectively in T cell activation and thymocyte development. Studies using LAT-deficient J.CaM2.5 cells and LAT knockout mice demonstrated that LAT mutants containing only the four membrane-distal tyrosines (referred to as LAT-4Y) could successfully restore T cell signaling . Furthermore, research revealed that LAT mutants capable of binding both Grb2 and PLC-γ1 could reconstitute T cell activation in LAT-deficient cells and thymocyte development in LAT-deficient mice .

This minimal requirement reflects the need for LAT to simultaneously organize multiple signaling components, creating a signaling hub that can integrate and amplify TCR-induced signals.

How does site-specific phosphorylation of LAT regulate differential signaling outcomes?

The phosphorylation pattern of LAT's multiple tyrosine residues creates a combinatorial code that determines which signaling pathways become activated. While ZAP-70 phosphorylates multiple tyrosines on LAT (specifically tyrosines 171, 191, and 226), these sites interact with adaptor proteins containing SH2 domains with different affinities and specificities .

The particular combination of phosphorylated tyrosines determines which downstream pathways are activated, allowing for fine-tuned control of T cell responses appropriate to specific stimuli.

What are the consequences of LAT mutations in T cell development and function?

Mutation or deletion of LAT significantly impairs TCR-mediated T cell responses . Research using mouse models demonstrates that:

  • Complete lack of functional LAT leads to a total arrest of T cell development

  • Inability for LAT to be phosphorylated similarly blocks thymocyte maturation

  • Mutation of three Grb2 binding sites (Y171, Y191, and Y226) simultaneously abolishes the interaction of LAT with Grb2 and Gads

  • Mutation of Y132 specifically disrupts PLC-γ1 binding, leading to defective Ras-MAPK activation and calcium flux

These findings underscore LAT's essential role as a signaling hub in T cell development and function, with distinct phosphorylation sites controlling different aspects of downstream signaling.

What are the best approaches for studying LAT phosphorylation dynamics?

When studying LAT phosphorylation dynamics, researchers should employ a combination of techniques:

  • Site-specific phospho-antibodies: Use antibodies that recognize specific phosphorylated tyrosine residues (pY132, pY171, pY191, and pY226) to track the temporal sequence of phosphorylation events.

  • Mutagenesis studies: Create point mutations (Tyr to Phe) of specific tyrosine residues to determine their individual contributions to LAT function, as demonstrated in studies where LAT mutants with combinations of two or three of the four membrane-distal tyrosines were created to examine their interactions with Grb2, Gads, and PLC-γ1 .

  • Phosphoproteomic analysis: Employ mass spectrometry-based approaches to identify all phosphorylation sites and their relative abundances under different stimulation conditions.

  • Co-immunoprecipitation assays: Use immunoprecipitation followed by anti-phosphotyrosine blotting to identify protein interactions dependent on specific phosphorylation events, as shown in studies where interactions of LAT mutants with Grb2, Gads, and PLC-γ1 were examined .

  • Live-cell imaging: Utilize fluorescently-tagged LAT and binding partners to visualize the spatial and temporal dynamics of LAT signaling complexes.

How can researchers effectively design reconstitution experiments with LAT mutants?

When designing reconstitution experiments with LAT mutants, consider the following methodological approach:

  • Selection of appropriate cell systems: Use LAT-deficient cell lines (such as J.CaM2.5) or primary cells from LAT knockout animals to eliminate background effects from endogenous LAT .

  • Retroviral or lentiviral expression systems: Employ vector systems that allow for stable expression of LAT variants at physiological levels. Ensure consistent expression levels across different mutants for valid comparisons .

  • Controls and markers: Include wild-type LAT and GFP-expressing controls for comparison. Using GFP as a marker for transduced cells allows for tracking reconstitution efficiency .

  • Functional readouts: Measure multiple downstream signaling events to comprehensively assess LAT function:

    • Calcium flux

    • MAPK pathway activation

    • Transcription factor activation (NF-AT, AP-1)

    • Cytokine production

  • In vivo validation: When possible, confirm cell line findings in animal models through adoptive transfer experiments, as shown in studies where LAT knockout mice were reconstituted with LAT-4Y to assess thymocyte development .

How should researchers make their LAT experimental data FAIR-compliant?

To make LAT experimental data compliant with FAIR principles (Findable, Accessible, Interoperable, Reusable), researchers should:

  • Implement standardized data management practices: Develop data management strategies that incorporate FAIR principles from the beginning of research projects rather than attempting to retrofit them later .

  • Use persistent identifiers: Assign DOIs (Digital Object Identifiers) to datasets to enhance findability and proper citation.

  • Apply rich metadata: Include comprehensive information about experimental conditions, reagents (including antibody catalog numbers and dilutions), cell types, and analytical methods.

  • Standardize data formats: Follow community standards for data structure and format to ensure interoperability. For LAT phosphorylation studies, this might include standardized reporting of phosphoproteomic data.

  • Deposit data in appropriate repositories: Submit data to field-specific repositories (like ImmPort for immunology data) or general repositories (like Figshare or Zenodo) with clear access conditions .

  • Document data processing steps: Provide detailed methods sections and analysis scripts (when applicable) to enable reproduction of findings.

What statistical approaches are most appropriate for analyzing complex LAT signaling data?

When analyzing complex LAT signaling data, consider these statistical approaches:

How might single-cell analysis technologies advance our understanding of LAT signaling heterogeneity?

Single-cell analysis technologies offer unprecedented opportunities to investigate the heterogeneity in LAT signaling across individual cells:

  • Single-cell phospho-flow cytometry: This approach allows quantification of LAT phosphorylation and downstream signaling events in thousands of individual cells, revealing population heterogeneity that might be masked in bulk analyses.

  • Single-cell RNA-seq: By correlating LAT signaling states with transcriptional outputs at the single-cell level, researchers can identify how variability in LAT signaling influences gene expression programs.

  • Mass cytometry (CyTOF): This technology enables simultaneous measurement of dozens of phosphorylation sites and other protein markers, providing a comprehensive view of how LAT phosphorylation patterns correlate with other signaling events.

  • Imaging mass cytometry: This method combines the multiplex capability of mass cytometry with spatial resolution, allowing researchers to examine LAT signaling in the context of the immunological synapse and other cellular structures.

  • Live-cell imaging of LAT signaling at single-molecule resolution: These approaches can reveal the dynamic assembly and disassembly of LAT-centered signaling complexes in real-time within individual cells.

What are the implications of LAT research for immunotherapy development?

LAT research has several important implications for immunotherapy development:

  • Targeted enhancement of T cell activation: Understanding the critical phosphorylation sites and protein interactions of LAT could guide the development of small molecules or biologics that enhance specific aspects of T cell signaling.

  • Biomarker development: LAT phosphorylation patterns might serve as biomarkers for T cell functionality and predict responses to immunotherapies.

  • Chimeric Antigen Receptor (CAR) T cell optimization: Insights from LAT signaling research can inform the design of next-generation CAR constructs with optimized signaling domains.

  • Overcoming T cell exhaustion: Knowledge of how LAT signaling changes during T cell exhaustion might suggest strategies to reinvigorate exhausted T cells in the tumor microenvironment.

  • Combination therapy rationales: Understanding how LAT integrates signals from multiple receptors can guide the development of rational combination immunotherapies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.