Recombinant Human Lipase maturation factor 1 (LMF1)

Shipped with Ice Packs
In Stock

Description

Structure and Molecular Function

LMF1 is a polytopic ER membrane protein with a luminal domain critical for interacting with nascent lipase subunits. Key structural and functional features include:

FeatureDescription
Domain OrganizationContains a conserved DUF1222 domain essential for lipase interaction .
ER LocalizationAnchored in the ER membrane, facilitating interactions with lipase monomers.
Chaperone ActivityGuides homodimer assembly or stabilizes active dimers of LPL, HL, and EL .
SpecificityActs on dimeric lipases (LPL, HL, EL) but not monomeric enzymes like pancreatic lipase .

Loss-of-function mutations (e.g., Y439X, W464X) in LMF1 disrupt lipase maturation, leading to ER retention and degradation of inactive enzymes. This results in combined lipase deficiency and severe hypertriglyceridemia in mice and humans .

Applications in Research and Diagnostics

Recombinant LMF1 is utilized in both experimental and clinical contexts:

Transgenic Models

Studies using tissue-specific LMF1 overexpression in mice (e.g., aP2-Lmf1, Mck-Lmf1 transgenics) revealed:

  • Adipose Tissues: Increased LPL specific activity without changes in protein mass .

  • Heart and Muscle: Elevated LPL mass due to reduced degradation, but unchanged specific activity .

  • Genetic Associations: Human LMF1 variants (e.g., rs3751666) correlate with post-heparin LPL activity in dyslipidemic cohorts .

Diagnostic Tools

The Human LMF1 ELISA Kit (Catalog #77519-636) enables precise quantification:

ParameterSpecification
Detection Range0.16–10 ng/ml
Sensitivity0.055 ng/ml
Sample TypesTissue homogenates, cell lysates, fluids
Assay Time~3.5 hours

This kit is critical for studying LMF1 expression in metabolic disorders .

Mechanistic Insights

  • Dimerization Dependency: LMF1 facilitates the assembly of inactive lipase monomers into active homodimers, as shown by ER co-purification with EL .

  • Tissue-Specific Effects: LMF1 overexpression in adipose vs. muscle tissues yields divergent outcomes in LPL mass/activity ratios, reflecting distinct regulatory pathways .

  • Genetic Modulation: LMF1 SNPs influence LPL activity in humans, though lipid-level associations remain weak due to polygenic influences .

Disease Relevance

  • Combined Lipase Deficiency: LMF1 mutations cause severe hypertriglyceridemia due to impaired LPL/HL/EL activity .

  • Therapeutic Potential: Modulating LMF1 expression could enhance lipase activity in metabolic syndromes, though compensatory mechanisms (e.g., upregulation of other lipases) may limit efficacy .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will strive to fulfill your requests.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
LMF1; C16orf26; TMEM112; HMFN1876; JFP11; Lipase maturation factor 1; Transmembrane protein 112
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-567
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
LMF1
Target Protein Sequence
MRPDSPTMAAPAESLRRRKTGYSDPEPESPPAPGRGPAGSPAHLHTGTFWLTRIVLLKAL AFVYFVAFLVAFHQNKQLIGDRGLLPCRVFLKNFQQYFQDRTSWEVFSYMPTILWLMDWS DMNSNLDLLALLGLGISSFVLITGCANMLLMAALWGLYMSLVNVGHVWYSFGWESQLLET GFLGIFLCPLWTLSRLPQHTPTSRIVLWGFRWLIFRIMLGAGLIKIRGDRCWRDLTCMDF HYETQPMPNPVAYYLHHSPWWFHRFETLSNHFIELLVPFFLFLGRRACIIHGVLQILFQA VLIVSGNLSFLNWLTMVPSLACFDDATLGFLFPSGPGSLKDRVLQMQRDIRGARPEPRFG SVVRRAANVSLGVLLAWLSVPVVLNLLSSRQVMNTHFNSLHIVNTYGAFGSITKERAEVI LQGTASSNASAPDAMWEDYEFKCKPGDPSRRPCLISPYHYRLDWLMWFAAFQTYEHNDWI IHLAGKLLASDAEALSLLAHNPFAGRPPPRWVRGEHYRYKFSRPGGRHAAEGKWWVRKRI GAYFPPLSLEELRPYFRDRGWPLPGPL
Uniprot No.

Target Background

Function
Lipase maturation factor 1 (LMF1) plays a crucial role in the maturation of specific proteins within the endoplasmic reticulum. It is essential for the maturation and transport of active lipoprotein lipase (LPL) through the secretory pathway. Each LMF1 molecule acts as a chaperone for 50 or more LPL molecules.
Gene References Into Functions
  1. Triglyceride-raising variant alleles of the LMF1 gene, encoding lipase maturation factor 1, have been linked to clinical Cardiovascular endpoints. PMID: 28534127
  2. Our findings suggest that LMF1 mutations are implicated in a significant proportion of cases with severe primary hypertriglyceridemia, highlighting the combined impact of rare mutations and polymorphisms typically associated with this disease. PMID: 25817768
  3. These results emphasize the critical role of the N-terminus of LMF1 in LPL maturation and the significance of the chaperone-to-substrate ratio. PMID: 24909692
  4. Lipase maturation factor 1 (Lmf1) is indispensable for endothelial lipase activity. Mutations in Lmf1 result in severe hypertriglyceridemia in both mice and human subjects. PMID: 21447484
  5. Studies have shown that cotransfection of LPL with wild-type Lmf1 restores its ability to support normal lipase maturation. PMID: 19471043
  6. Data demonstrates the arrangement of an evolutionarily conserved domain within LMF1 (DUF1222) that is essential for lipase maturation. PMID: 19783858
  7. The identification of a second novel pathogenic mutation in the LMF1 gene in a patient with severe hypertriglyceridemia. PMID: 19820022

Show More

Hide All

Database Links

HGNC: 14154

OMIM: 246650

KEGG: hsa:64788

STRING: 9606.ENSP00000262301

UniGene: Hs.71912

Involvement In Disease
Combined lipase deficiency (CLD)
Protein Families
Lipase maturation factor family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Lipase Maturation Factor 1 and what is its primary function?

Lipase maturation factor 1 (LMF1) is a membrane-bound protein located in the endoplasmic reticulum (ER). It plays an essential role in the folding and assembly (maturation) of a select group of lipases including lipoprotein lipase (LPL), hepatic lipase (HL), and endothelial lipase (EL). These lipases are critical for plasma triglyceride metabolism and high-density lipoprotein cholesterol regulation. LMF1 appears to be specifically involved in the proper maturation of dimeric lipases, suggesting it functions in the assembly and/or stabilization of head-to-tail lipase homodimers during the post-translational maturation process .

What is the cellular localization and topology of LMF1?

LMF1 is a membrane-bound protein localized in the endoplasmic reticulum. Its topology has been characterized through detailed structural analysis. The protein contains multiple membrane-spanning domains and a large, evolutionarily conserved domain called DUF1222, which extends into the ER lumen. This DUF1222 domain is essential for interaction with lipases and their attainment of enzymatic activity. Subcellular localization studies have confirmed that both wild-type and mutant LMF1 proteins are localized in the cell cytoplasm, specifically within the ER membrane system .

What lipases require LMF1 for proper maturation?

LMF1 is required for the maturation of a specific subset of lipases, namely those that form dimeric structures. The three main lipases known to depend on LMF1 for proper folding and assembly are:

  • Lipoprotein lipase (LPL)

  • Hepatic lipase (HL)

  • Endothelial lipase (EL)

These lipases share structural similarities and all contribute significantly to plasma triglyceride and high-density lipoprotein cholesterol metabolism. LMF1 appears specifically necessary for lipases that assemble into homodimers in the endoplasmic reticulum, suggesting a specialized role in dimer formation or stabilization .

What are the consequences of LMF1 deficiency?

LMF1 deficiency results in combined lipase deficiency, characterized by severely reduced activity of multiple lipases (LPL, HL, and EL). This leads to marked hypertriglyceridemia in both humans and mouse models. Clinically, patients with loss-of-function mutations in LMF1 present with severe hypertriglyceridemia and associated complications. At the molecular level, LMF1 deficiency prevents proper maturation of lipases, resulting in misfolded lipase proteins that fail to attain enzymatic activity despite normal synthesis. The affected lipases remain inactive and are unable to be secreted properly, compromising lipid metabolism pathways throughout the body .

What expression systems are most effective for producing recombinant human LMF1?

For recombinant human LMF1 expression, mammalian cell systems are typically preferred due to the protein's complex topology and requirement for proper ER localization. HEK293T cells have been successfully employed for LMF1 expression studies, allowing for proper protein folding and membrane insertion. For expression constructs, vectors containing strong promoters such as pEGFP-N1 have proven effective. The full coding sequence of LMF1 should be cloned using appropriate restriction enzymes (such as BglII and SalI) to ensure correct orientation and reading frame. To maximize expression efficiency, codon optimization for the host system may be beneficial, particularly when expressing the protein in non-human cell lines .

How can LMF1-lipase interactions be effectively studied in vitro?

LMF1-lipase interactions can be studied through multiple complementary approaches:

  • Co-immunoprecipitation assays: By co-expressing tagged versions of LMF1 and target lipases (LPL, HL, or EL), researchers can pull down protein complexes to confirm direct interactions.

  • Lipase activity assays: Measuring lipase activity in cell medium and lysates after co-expression with wild-type or mutant LMF1 provides functional evidence of interaction. This approach has demonstrated that LMF1 mutations cause decreased LPL levels in both cell medium and lysates.

  • Fluorescence microscopy: Using GFP-tagged LMF1 constructs allows visualization of subcellular localization and potential co-localization with lipases.

  • Site-directed mutagenesis: Creating specific mutations in the conserved DUF1222 domain helps identify critical residues for lipase interaction, as demonstrated in studies showing that mutations in LMF1 significantly impact LPL activity and expression .

What methods are used to assess the impact of LMF1 mutations on protein structure?

Several bioinformatic and experimental approaches can assess how LMF1 mutations affect protein structure:

  • 3D structure prediction: I-TASSER (Iterative Threading ASSEmbly Refinement) can be used to predict the three-dimensional structures of wild-type and mutant LMF1 proteins based on amino acid sequences. This computational approach has revealed that mutations like c.1523C>T change the tertiary structure of the protein.

  • Conservation analysis: Tools such as Polyphen-2 can determine if mutations affect highly conserved regions across species, indicating potential functional significance. For example, the 508 locus in the LMF1 protein has been shown to be highly conserved between different species.

  • Expression analysis: Quantifying mRNA and protein levels of wild-type versus mutant LMF1 provides insight into stability effects. Studies have shown decreased mRNA and protein expression in cells transfected with plasmids carrying the LMF1 c.1523C>T mutation.

  • Subcellular localization studies: Fluorescence microscopy can confirm whether mutations affect proper ER localization, though both wild-type and mutant LMF1 proteins have been shown to localize to the cell cytoplasm .

What transgenic approaches have been used to study LMF1 function in vivo?

Transgenic mouse models have provided valuable insights into LMF1 function in vivo:

  • Tissue-specific overexpression: Two transgenic mouse lines have been developed to study the effects of LMF1 overexpression:

    • aP2-Lmf1 mice (overexpression in adipose tissue)

    • Mck-Lmf1 mice (overexpression in heart and muscle tissue)

  • Phenotypic analysis: These transgenic models have demonstrated that LMF1 overexpression increases LPL activity in multiple tissues, though through different mechanisms depending on the tissue type.

  • Tissue-specific effects: In omental and subcutaneous adipose tissues, LMF1 overexpression increased LPL specific activity without changing LPL mass. In contrast, in heart and gonadal adipose tissue, the increased LPL activity was due to elevated LPL protein levels.

These approaches have established that beyond its role as a required factor, the expression level of LMF1 is also a determinant of LPL activity in vivo, suggesting potential therapeutic implications .

What are the known pathogenic mutations in human LMF1 and their functional consequences?

Several pathogenic mutations in the human LMF1 gene have been identified and characterized:

  • Truncating mutations: Mutations that result in the truncation of the large, evolutionarily conserved DUF1222 domain are particularly detrimental. This domain is essential for interaction with lipases and their attainment of enzymatic activity.

  • Specific mutations: The c.1523C>T missense mutation in exon 10 of the LMF1 gene has been identified in patients with hypertriglyceridemia. Functional studies demonstrate that this mutation:

    • Changes the tertiary structure of the protein

    • Decreases mRNA and protein expression

    • Reduces LPL mass in both cell medium and cell lysates

  • Combined effects: When combined with mutations in lipase genes such as LPL (e.g., c.590G>A), LMF1 mutations can have synergistic negative effects on lipase activity. For instance, LMF1 and LPL double mutants significantly decrease LPL levels compared to the individual effects of either mutation alone .

How do genetic variations in LMF1 affect lipase activity and lipid metabolism in humans?

Genetic variations in LMF1 have significant impacts on lipase activity and lipid metabolism:

  • Association with lipase activity: Common genetic variants (SNPs) in the LMF1 gene have been associated with post-heparin LPL activity in dyslipidemic cohorts, indicating that even non-pathogenic variations can influence lipase function.

  • Tissue-dependent effects: The effects of LMF1 genetic variation appear to differ across tissues, suggesting complex regulatory mechanisms. In some tissues, LMF1 variants affect LPL specific activity, while in others they primarily influence LPL mass.

  • Hypertriglyceridemia risk: LMF1 genetic variations contribute to hypertriglyceridemia risk, particularly when combined with variants in lipase genes like LPL. This digenic or polygenic effect highlights the complex genetic architecture of lipid disorders.

  • Phenotypic severity: The severity of the phenotype (degree of hypertriglyceridemia) correlates with the functional impact of the LMF1 variants, with complete loss-of-function mutations causing the most severe manifestations .

What experimental approaches can be used to assess the combined effects of LMF1 and lipase gene mutations?

To evaluate the combined effects of LMF1 and lipase gene mutations, researchers can employ several experimental approaches:

  • Co-expression systems: Transfect cells with plasmids carrying wild-type and mutant versions of both LMF1 and lipase genes (e.g., LPL) to assess their combined effects on lipase activity and expression.

  • Quantitative measurements: Measure lipase mass and activity in both cell medium and cell lysates to determine the relative contributions of each mutation and their synergistic effects.

  • Structure-function analysis: Use computational tools like I-TASSER and Polyphen-2 to predict how mutations in both genes affect protein structure and conservation.

  • Genotype-phenotype correlations: In human studies, analyze the association between genetic variants in both LMF1 and lipase genes with clinical parameters such as plasma triglyceride levels and post-heparin lipase activity.

These approaches have demonstrated that the combination of LMF1 and LPL gene mutations significantly decreases LPL levels compared to their individual effects, suggesting important digenic contributions to hypertriglyceridemia .

What is known about the molecular mechanism of LMF1-mediated lipase maturation?

The molecular mechanism of LMF1-mediated lipase maturation involves several key steps:

  • Timing in the maturation process: LMF1 functions in the later stages of lipase maturation, after initial folding and glycosylation have occurred. Lipases still undergo normal early maturation steps in the absence of LMF1.

  • Dimer stabilization: LMF1 likely plays a critical role in the assembly and/or stabilization of head-to-tail lipase homodimers. This is supported by its apparent specificity for dimeric lipases such as LPL, HL, and EL.

  • Protection from misfolding: LMF1 may shield lipase monomers and homodimers from the ER environment that could otherwise promote their misfolding. It may also prevent homodimer disassembly in the ER prior to secretion.

  • Domain-specific interactions: The conserved DUF1222 domain of LMF1 is essential for interaction with lipases and their attainment of enzymatic activity, suggesting a specific binding interaction that promotes proper folding and/or assembly .

How does LMF1 overexpression affect lipase activity in different tissues?

LMF1 overexpression has distinct effects on lipase activity across different tissues:

  • Adipose tissue effects:

    • In omental and subcutaneous adipose tissues, LMF1 overexpression increases LPL specific activity without changing LPL mass

    • In gonadal adipose tissue, LMF1 overexpression increases LPL mass rather than specific activity

  • Heart and muscle effects:

    • In heart tissue, LMF1 overexpression primarily increases LPL mass

    • Even several-fold overexpression of LMF1 results in only 30-50% increases in LPL activity, suggesting potential saturation effects

  • Tissue-specific mechanisms:

    • These differences suggest distinct regulatory mechanisms for LPL activity across tissues

    • The relative impact of LMF1 overexpression correlates with the degree of transgene expression across different tissues

These tissue-specific effects highlight the complex role of LMF1 in regulating lipase activity and suggest that therapeutic approaches targeting LMF1 may need to account for tissue-specific responses .

What techniques can be used to study the structural topology of LMF1 in the ER membrane?

Several specialized techniques can be employed to study LMF1's structural topology in the ER membrane:

  • Glycosylation site mapping: By introducing glycosylation sites at various positions along the LMF1 sequence, researchers can determine which regions are exposed to the ER lumen (where glycosylation machinery is located) versus the cytosol.

  • Protease protection assays: Treating isolated microsomes with proteases can reveal which domains of LMF1 are protected by the ER membrane versus exposed to cytosolic degradation.

  • Fluorescence microscopy with domain-specific tags: Attaching fluorescent tags to specific domains and determining their localization relative to ER markers can help establish membrane topology.

  • Computational prediction: Algorithms that predict transmembrane domains based on hydrophobicity and other parameters can provide initial models of LMF1 topology.

These approaches have been used to solve the topology of LMF1 in the ER membrane, revealing its structural complexity and providing insights into how it interacts with client lipases during the maturation process .

What is the relationship between LMF1 and ER quality control mechanisms?

LMF1 functions within the context of broader ER quality control mechanisms:

  • Integration with ER folding machinery: LMF1 likely works in conjunction with other ER chaperones and folding factors to ensure proper lipase maturation, though the specific interactions remain to be fully characterized.

  • Role in preventing ER stress: By promoting proper lipase folding and assembly, LMF1 helps prevent the accumulation of misfolded proteins that could trigger ER stress responses.

  • Late-stage quality control: LMF1 appears to function in later stages of lipase maturation, suggesting it may be part of a final quality control checkpoint before lipases are approved for secretion.

  • Tissue-specific regulation: The differential effects of LMF1 on lipase activity across tissues may reflect tissue-specific ER quality control environments and requirements.

Understanding how LMF1 integrates with broader ER quality control mechanisms could provide insights into both normal physiology and disease states associated with lipase dysfunction .

What are the potential therapeutic implications of modulating LMF1 expression or activity?

Modulating LMF1 expression or activity holds several potential therapeutic implications:

  • Treatment for hypertriglyceridemia: Since LMF1 overexpression increases LPL activity in various tissues, enhancing LMF1 function could potentially increase triglyceride clearance and reduce plasma triglyceride levels.

  • Personalized approaches: Genetic testing for LMF1 variants could help identify patients who might benefit from therapies targeting LMF1 or downstream pathways. Individuals with partial LMF1 deficiency might especially benefit from interventions that enhance remaining LMF1 activity.

  • Combined therapeutic strategies: The synergistic effects observed between LMF1 and LPL mutations suggest that combined therapeutic approaches targeting both pathways might be more effective than single-target approaches for certain forms of dyslipidemia.

  • Tissue-specific interventions: The differential effects of LMF1 across tissues suggest that tissue-targeted therapeutic approaches may be necessary to achieve optimal outcomes without unwanted side effects .

What new technologies or approaches might advance our understanding of LMF1 function?

Several emerging technologies and approaches could significantly advance our understanding of LMF1 function:

  • Cryo-EM structure determination: Determining the precise three-dimensional structure of LMF1, particularly in complex with client lipases, would provide crucial insights into its mechanism of action.

  • CRISPR/Cas9 genome editing: Creating precise knock-in models of human LMF1 mutations could provide more physiologically relevant systems to study disease mechanisms and test therapeutic interventions.

  • Conditional knockout models: Tissue-specific and inducible LMF1 knockout models would allow for more detailed analysis of its tissue-specific functions without the confounding effects of developmental compensation.

  • Proteomics approaches: Comprehensive analysis of the LMF1 interactome could identify additional interaction partners and regulatory factors beyond the currently known lipases.

  • Single-cell analysis: Examining the effects of LMF1 variation at the single-cell level could reveal cell-specific responses and heterogeneity that may be masked in bulk tissue analyses .

How might the study of LMF1 inform our understanding of other ER chaperones and protein quality control systems?

The study of LMF1 provides a valuable model for understanding broader principles of ER chaperone function:

  • Substrate specificity: LMF1's apparent specificity for dimeric lipases offers insights into how chaperones can evolve to serve specific client subsets rather than functioning as general folding factors.

  • Membrane protein topology and function: The complex membrane topology of LMF1 and its functional domains provides a model for how membrane-bound chaperones operate within the constraints of the ER membrane.

  • Disease mechanisms: LMF1-associated disorders illustrate how defects in specific chaperones can lead to selective protein maturation defects and consequently to specific disease phenotypes.

  • Evolutionary conservation: The conservation of LMF1 across species highlights fundamental aspects of protein quality control that have been maintained throughout evolution.

These insights from LMF1 research can inform models of how other specialized chaperones might function within the broader context of ER protein quality control systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.