Recombinant Human Lipid phosphate phosphatase-related protein type 5 (LPPR5)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Human Lipid Phosphate Phosphatase-Related Protein Type 5 (LPPR5), also known as Phospholipid Phosphatase-Related Protein Type 5 (PLPPR5), Plasticity-Related Gene 5 (PRG5), or PAP2D, is a six-transmembrane domain protein belonging to the lipid phosphatase/phosphotransferase (LPT) family. It is primarily expressed in the central nervous system and plays roles in neuronal plasticity, cancer biology, and lipid signaling . Recombinant LPPR5 is engineered for research applications, enabling mechanistic studies of its biological functions and therapeutic potential.

Recombinant Production Systems

Recombinant LPPR5 is expressed in diverse host systems for functional studies:

Host SystemPurityApplicationsKey Features
Escherichia coli≥85%Structural studies, antibody productionCost-effective, high yield
Pichia pastoris≥85%Large-scale production, glycosylationEukaryotic post-translational modifications
Mammalian Cells (HEK-293)≥90%Functional assays, therapeutic researchNative folding and activity
Cell-Free Expression≥85%Rapid prototyping, toxic proteinsNo host viability constraints

Pichia pastoris is favored for producing secreted, glycosylated LPPR5 due to its high-density fermentation capabilities and compatibility with human-like glycosylation pathways .

Neuronal Plasticity and Development

LPPR5 modulates RhoA-GTPase signaling, counteracting lysophosphatidic acid (LPA)-induced neurite retraction and promoting filopodia formation . Key mechanisms include:

  • Lipid Binding: Binds extracellular LPA but does not hydrolyze it .

  • Cytoskeletal Regulation: Inhibits RhoA activation, stabilizing actin networks .

  • Synaptic Transmission: Interacts with PP2A and calmodulin to regulate synaptic plasticity .

Cancer Biology

StudyKey FindingImplication
Glioma (Stange et al., 2022)LPPR5 overexpression reduces tumor growth, VEGF secretion, and vascular dysfunction .Anti-angiogenic therapeutic potential
Glioblastoma (TCGA Cohort)LPPR5 downregulation correlates with mesenchymal subtype and poor prognosis .Biomarker for tumor aggressiveness
Breast Cancer (Bao et al., 2019)PLPPR5 deletion enhances metastasis via RhoA activation .Tumor suppressor role

Protein Interactions

LPPR5 forms homo- and hetero-oligomers with other PLPPR family members (e.g., LPPR1, LPPR3, LPPR4), modulating shared signaling pathways .

Research Applications

Recombinant LPPR5 is utilized in:

  • Antibody Development: Polyclonal antibodies target epitopes in the N-terminal (e.g., residues 282–321) .

  • Biochemical Assays: ELISA, Western blot, and immunohistochemistry for protein quantification .

  • Therapeutic Screening: Evaluated in sunitinib-resistant gliomas for anti-angiogenic synergy .

Future Directions

  1. Clinical Translation: Explore LPPR5 as a biomarker or therapeutic target in glioblastoma and neurodevelopmental disorders.

  2. Mechanistic Studies: Resolve LPPR5-LPA structural interactions using cryo-EM.

  3. Engineering: Optimize Pichia pastoris strains for hyperglycosylated LPPR5 to enhance stability .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have a specific requirement for the format, please indicate your preference in the order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
PLPPR5; LPPR5; PAP2D; PRG5; Phospholipid phosphatase-related protein type 5; Lipid phosphate phosphatase-related protein type 5; Phosphatidic acid phosphatase type 2d; Plasticity-related gene 5 protein; PRG-5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-321
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
PLPPR5
Target Protein Sequence
MPLLPAALTSSMLYFQMVIMAGTVMLAYYFEYTDTFTVNVQGFFCHDSAYRKPYPGPEDS SAVPPVLLYSLAAGVPVLVIIVGETAVFCLQLATRDFENQEKTILTGDCCYINPLVRRTV RFLGIYTFGLFATDIFVNAGQVVTGNLAPHFLALCKPNYTALGCQQYTQFISGEEACTGN PDLIMRARKTFPSKEAALSVYAAMYLTMYITNTIKAKGTRLAKPVLCLGLMCLAFLTGLN RVAEYRNHWSDVIAGFLVGISIAVFLVVCVVNNFKGRQAENEHIHMDNLAQMPMISIPRV ESPLEKVTSVQNHITAFAEVT
Uniprot No.

Target Background

Function
Induces filopodia formation and promotes neurite growth in a CDC42-independent manner; impedes neurite growth inhibitory-mediated axonal retraction.
Gene References Into Functions
  1. A novel human phosphatidic acid phosphatase type 2 isoform cDNAs (PAP2d) from the fetal brain cDNA library was cloned and characterized. PMID: 16010976
Database Links

HGNC: 31703

KEGG: hsa:163404

UniGene: Hs.483948

Protein Families
PA-phosphatase related phosphoesterase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Isoform 1 is expressed in brain, lung, kidney and colon. Isoform 2 is expressed in placenta, skeletal muscle and kidney.

Q&A

What is Human Lipid phosphate phosphatase-related protein type 5 and what are its key genetic characteristics?

Human Lipid phosphate phosphatase-related protein type 5 (LPPR5), also known as PLPPR5 or PRG5, is a six-transmembrane protein primarily expressed in central nervous system tissues. It functions as a modulator of the Rho-GTPase pathway, impeding NogoA- and LPA-mediated RhoA kinase signaling, which influences cancer growth, vascularization, and adaptive responses to microenvironment changes .

Genetically, LPPR5 is encoded by the LPPR5 gene (GeneID: 163404) located on chromosome 1, specifically on the 1p allele - a locus commonly deleted in oligodendroglioma . Its molecular identity includes:

CharacteristicInformation
UniProt Primary ACQ32ZL2
UniProt Entry NamePLPR5_HUMAN
Gene SymbolLPPR5
GeneID163404
HGNC31703
KEGGhsa:163404

LPPR5 is particularly interesting to researchers because of its role in neuronal plasticity and its potential tumor-suppressive functions in glioma, where its expression is often downregulated with increasing malignancy .

What are the most reliable methods for detecting and quantifying LPPR5 in biological samples?

Several methodological approaches can be employed for detecting and quantifying LPPR5, with ELISA being the most commonly used for precise quantitative measurements:

ELISA-based detection:
Commercial ELISA kits for Human Lipid phosphate phosphatase-related protein type 5 typically employ a colorimetric detection method with a test range of 0.156-10 ng/ml . These kits are optimized for native samples including tissue homogenates, cell lysates, and other biological fluids. For accurate results, researchers should:

  • Dilute samples to fall within the mid-range of the kit's detection capabilities

  • Store kits at 4°C upon receipt and follow kit-specific instructions

  • Perform the assay with consistent laboratory conditions to minimize performance fluctuations

  • Complete the entire assay with the same operator to ensure consistency

Additional detection methods:

  • Immunohistochemistry/immunofluorescence for tissue localization studies

  • Western blotting for protein size verification and semi-quantitative analysis

  • qRT-PCR for mRNA expression analysis

When designing LPPR5 detection experiments, researchers should note that recombinant proteins may have different sequences or tertiary structures compared to native LPPR5, potentially affecting detection accuracy .

How should researchers design experiments to investigate LPPR5 effects on glioma growth and vascularization?

Based on published methodologies, a comprehensive experimental design should include:

  • Experimental models selection:

    • GL261 murine orthotopic allograft glioma model has been successfully used to study LPPR5 functions

    • Consider both in vitro (cell lines) and in vivo (xenograft) approaches for comprehensive analysis

  • Experimental groups:

    • Control group with wild-type LPPR5 expression

    • LPPR5 overexpression (LPPR5OE) group

    • Optional: LPPR5 knockdown group via siRNA or CRISPR/Cas9

    • Treatment groups (e.g., with sunitinib or other targeted therapies)

  • Key parameters to measure:

    • Tumor growth rate and volume over time

    • Apoptosis markers (e.g., TUNEL assay)

    • Vascular endothelial growth factor A (VEGF-A) expression and secretion

    • Micro-angioarchitecture characteristics using epicortical intravital epi-illumination fluorescence video microscopy

  • Data collection timeline:

    • Establish baseline measurements before intervention

    • Regular interval measurements during tumor growth

    • Final comprehensive analysis at experimental endpoint

  • Data analysis approach:

    • Statistical comparison between experimental groups

    • Correlation analyses between LPPR5 expression and tumor characteristics

    • Multivariate analysis to control for confounding factors

This experimental design allows for comprehensive assessment of how LPPR5 affects tumor biology, particularly focusing on the documented effects on growth delay and vascular architecture .

How does LPPR5 expression correlate with glioma malignancy and molecular subtypes?

Research indicates a significant correlation between LPPR5 expression and glioma characteristics:

  • Expression patterns across glioma subtypes:

    • Highest expression is typically found in proneural glioma subtypes, characterized by expression of neurogenesis markers PDGFRA, NKX2-2, and OLIG2

    • Significantly lower expression in mesenchymal glioma subtypes compared to classical subtypes

    • Neural subtypes also show significant downregulation of LPPR5

    • Expression decreases with increasing malignancy grades

  • Molecular associations:

    • Proneural subtypes with high LPPR5 expression are frequently IDH1 mutants

    • The 1p allele, where LPPR5 is located, is commonly deleted in oligodendroglioma, though the biological significance remains under investigation

  • Functional implications:

    • Downregulation corresponds to more aggressive growth patterns

    • Lower expression correlates with less favorable prognosis

    • May serve as a molecular marker for disease classification

This expression pattern suggests LPPR5 may function as a tumor suppressor, with its loss contributing to more aggressive disease. The correlation with specific molecular subtypes also implies LPPR5 could serve as a biomarker for tumor classification or prognostication .

What mechanisms explain LPPR5's effects on glioma vasculature and potential therapy resistance?

LPPR5 overexpression in glioma models leads to several significant changes in tumor biology that explain its effects on vasculature and therapy response:

  • Effects on angiogenic signaling:

    • Decreased expression and secretion of vascular endothelial growth factor A (VEGF-A) in LPPR5OE tumors

    • Altered RhoA kinase signaling pathway, which normally promotes angiogenesis

    • Potential modulation of other angiogenic factors, though these require further characterization

  • Vascular architecture alterations:

    • Development of dysfunctional small blood vessels in LPPR5OE tumors

    • Altered micro-angioarchitecture with functional compromise

    • Abnormal vessel morphology compared to control tumors

  • Therapy response mechanisms:

    • Antiangiogenic therapy (sunitinib) eliminates the abnormal vessels in LPPR5OE tumors

    • Surprisingly, vessel elimination has no effect on tumor growth or apoptosis

    • This suggests LPPR5-overexpressing tumors develop alternative survival mechanisms despite compromised vasculature

    • May represent a novel mechanism of therapy resistance to antiangiogenic treatments

  • Cellular effects:

    • Increased tumor cell apoptosis in LPPR5OE models

    • Delayed and decelerated tumor growth

    • Development of a more benign, proapoptotic phenotype

These mechanisms collectively contribute to a complex phenotype where LPPR5 overexpression creates tumors with compromised vasculature but paradoxical resistance to antiangiogenic therapy, highlighting the need for combination approaches when targeting such tumors .

How can researchers address data contradictions in LPPR5 literature using systematic methodology?

Addressing contradictions in research literature about LPPR5 requires a systematic approach:

  • Types of contradictions to identify :

    • Self-contradictory documents: Single papers containing internally inconsistent information about LPPR5

    • Contradicting document pairs: Two publications presenting conflicting data on LPPR5 functions

    • Conditional contradictions: Cases where information in one study creates a contradiction between two other studies on LPPR5

  • Systematic conflict detection methodology:

    • Implement a formal contradiction detection framework for literature review

    • Classify contradictions by type (self, pair, or conditional)

    • Evaluate whether contradictions involve important or peripheral statements

    • Assess the relative positions of contradicting information in documents

    • Quantify the amount of conflicting evidence

  • Experimental approaches to resolve contradictions:

    • Design confirmatory experiments specifically addressing the contradictory findings

    • Employ multiple model systems to test generalizability

    • Use both gain-of-function and loss-of-function approaches

    • Implement varied detection methodologies to overcome technique-specific limitations

  • Data analysis strategies:

    • Apply chain-of-thought reasoning to analyze contradictions systematically

    • Consider model sensitivity to statement importance

    • Evaluate document proximity effects on contradiction detection

    • Assess how evidence length affects contradiction analysis

Researchers should note that large language models used for literature analysis show varying abilities to detect different contradiction types, with pair contradictions being most readily identified (up to 89.3% accuracy) while self-contradictions are most challenging to detect (as low as 0.6% accuracy with some analysis methods) .

What considerations should researchers address when preparing RPPR reports on LPPR5 research for NIH-funded projects?

When preparing Research Performance Progress Reports (RPPR) for NIH-funded LPPR5 research, investigators should address the following key considerations according to NIH guidelines:

  • Report structure and formatting :

    • Adhere to NIH's specific RPPR format requirements

    • Use standard paper size (8 ½" x 11") with at least one-half inch margins

    • Employ clear English language and avoid jargon

    • Define abbreviations upon first use

    • Submit all progress reports using the RPPR module in eRA Commons

  • Key sections to focus on :

    • Section B (Accomplishments): Detail specific findings related to LPPR5 function, expression patterns, or therapeutic implications

    • Section C (Products): List all publications, patents, or resources developed

    • Section E (Impact): Explain how findings contribute to glioma biology understanding

    • Section G (Special Reporting Requirements): Address any special requirements for work with biological materials

  • Publication reporting :

    • For predoctoral trainees (Table 5A): List all publications resulting from LPPR5 research during training

    • For postdoctoral trainees (Table 5B): Document publications from training period, excluding work done prior to joining

    • Bold the trainee's name in author lists

    • Document publications chronologically

    • Note "No Publications" for trainees without publications and provide explanatory phrases

  • Research support documentation :

    • In Table 4, list all current research support for participating faculty

    • Include funding source, grant number, project period, and project title

    • Exclude pending applications, administrative supplements, and no-cost extensions

    • Include only the component information for multi-project grants where faculty serve as project leaders

Following these guidelines ensures compliance with NIH reporting requirements while effectively communicating research progress on LPPR5 .

How should researchers properly design and format data tables for LPPR5 expression experiments?

Creating well-designed data tables for LPPR5 expression experiments requires attention to several key principles:

  • Table structure and design 11 :

    • Title the table appropriately (e.g., "Expression Levels of LPPR5 Across Glioma Subtypes")

    • Determine appropriate number of rows and columns based on experimental design

    • Place manipulated variables (e.g., cell type, treatment condition) in the left column

    • Include raw data in middle columns and processed data (averages, standard deviations) in right columns

    • Draw lines around all rows and columns to enhance readability

    • Ensure consistent precision (decimal places) throughout the table

  • Column labeling requirements :

    • Include clear headers for each column

    • Specify units of measurement (e.g., ng/ml, relative expression)

    • Indicate measurement uncertainty where applicable

    • Include trial numbers for replicate experiments

  • Data presentation guidelines11 :

    • Record all experimental data in appropriate columns

    • Ensure information is clear and obvious to anyone viewing the table

    • Use consistent significant digits throughout

    • Include all necessary controls

Example of properly formatted table for LPPR5 expression analysis:

Glioma SubtypeLPPR5 Expression Level (Relative Units)Standard Deviation (±)Sample Size (n)p-value (vs. Normal)
Proneural0.850.12150.042
Classical0.620.09150.008
Mesenchymal0.310.0715<0.001
Neural0.430.08150.003
Normal Brain1.000.1410N/A

This table structure follows the "tidy data" principles: each variable has its own column, each observation has its own row, and each value has its own cell .

What analytical approaches should be used to evaluate LPPR5's impact on glioma growth and vascular architecture?

To comprehensively analyze LPPR5's effects on glioma growth and vascular architecture, researchers should implement a multi-faceted analytical approach:

  • Tumor growth analysis:

    • Measure and plot tumor volume over time using appropriate imaging techniques

    • Calculate growth rates using exponential or linear regression models

    • Compare growth delay (time to reach specific volume) between control and LPPR5OE tumors

    • Perform survival analysis if using animal models with defined endpoints

  • Vascular architecture assessment :

    • Quantify vessel density (vessels per high-power field)

    • Measure vessel diameter distribution

    • Analyze vessel branching patterns

    • Assess vessel functionality through perfusion studies

    • Examine vessel maturity via pericyte coverage

  • Molecular profiling:

    • Quantify VEGF-A expression and secretion using ELISA or Western blot

    • Analyze RhoA activity with GTPase activation assays

    • Measure apoptosis markers (cleaved caspase-3, TUNEL)

    • Evaluate proliferation markers (Ki-67, phospho-histone H3)

  • Treatment response evaluation:

    • Compare antiangiogenic therapy effects (e.g., sunitinib) between control and LPPR5OE tumors

    • Analyze vessel elimination patterns following treatment

    • Correlate vessel changes with tumor growth patterns

    • Identify potential resistance mechanisms

  • Statistical approaches:

    • Use appropriate statistical tests (t-test, ANOVA) for group comparisons

    • Perform correlation analyses between LPPR5 expression and vascular parameters

    • Conduct multivariate analysis to identify key predictive factors

    • Calculate effect sizes to determine biological significance beyond statistical significance

Research has demonstrated that LPPR5 overexpression generates a more benign, proapoptotic glioma phenotype with delayed growth and a dysfunctional vascular architecture, making these analytical approaches particularly relevant for understanding its therapeutic potential and mechanisms of action .

How can contradictions in LPPR5 research findings be systematically resolved and integrated into coherent models?

Addressing contradictions in LPPR5 research requires a structured approach to analysis and integration:

  • Contradiction identification framework :

    • Categorize contradictions by type: self-contradictory, pair contradictions, or conditional contradictions

    • Assess whether contradictions involve central claims or peripheral details

    • Evaluate the methodological rigor of conflicting studies

    • Consider biological context differences (cell types, models, experimental conditions)

  • Resolution strategies:

    • Design validation experiments specifically targeting contradictory findings

    • Implement meta-analysis techniques when multiple studies address similar questions

    • Consider conditional validity - identify specific conditions under which each finding holds true

    • Develop unified models that accommodate seemingly contradictory results

  • Response generation consistency analysis :

    • Analyze the consistency of n-best lists when evaluating contradictory findings

    • Use polar questions as stimulus inputs for concise and quantitative analyses

    • Evaluate the contextual contradiction-awareness of response generation models

    • Avoid generating new contradictions when synthesizing research findings

  • Integration approach:

    • Develop pathway models that accommodate context-dependent LPPR5 functions

    • Create clear visual representations of integrated models

    • Explicitly acknowledge remaining uncertainties

    • Propose testable hypotheses that could resolve persistent contradictions

This systematic approach helps researchers navigate the complex and sometimes contradictory literature on LPPR5, allowing for more coherent understanding of its biological functions and therapeutic potential .

What are the most promising future research directions for LPPR5 in glioma biology and potential therapeutic applications?

Based on current knowledge gaps and emerging evidence, several high-priority research directions for LPPR5 warrant investigation:

  • Mechanistic studies:

    • Detailed characterization of LPPR5's interaction with the Rho-GTPase pathway in glioma

    • Investigation of LPPR5's role in tumor cell apoptosis mechanisms

    • Analysis of LPPR5-mediated regulation of VEGF-A expression and secretion

    • Examination of potential interactions with other signaling pathways

  • Clinical correlations:

    • Comprehensive analysis of LPPR5 expression across larger cohorts of glioma patients

    • Development of LPPR5 as a prognostic or predictive biomarker

    • Correlation of LPPR5 levels with response to standard therapies

    • Assessment of LPPR5 expression in recurrent versus primary tumors

  • Therapeutic approaches:

    • Evaluation of LPPR5 as a therapeutic target or delivery approach

    • Investigation of combination therapies targeting LPPR5 and complementary pathways

    • Development of methods to induce LPPR5 expression in glioma cells

    • Testing strategies to overcome resistance to antiangiogenic therapies in LPPR5-expressing tumors

  • Advanced models:

    • Creation of conditional knockout or inducible expression systems for LPPR5

    • Development of patient-derived xenograft models with varying LPPR5 expression

    • Implementation of 3D organoid cultures to better recapitulate tumor microenvironment

    • Application of intravital imaging for real-time assessment of LPPR5 effects

  • Translational applications:

    • Screening for small molecules that can modulate LPPR5 activity

    • Exploration of LPPR5 as a target for immunotherapy approaches

    • Development of imaging approaches to visualize LPPR5 expression in vivo

    • Investigation of LPPR5's role in blood-brain barrier function and drug delivery

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.