Recombinant Human Lipoma HMGIC fusion partner-like 1 protein (LHFPL1)

Shipped with Ice Packs
In Stock

Description

Introduction

Lipoma HMGIC fusion partner-like 1 protein (LHFPL1) is a protein encoded by the LHFPL1 gene in humans . The LHFPL1 gene is part of the lipoma HMGIC fusion partner (LHFP) gene family, a subset of the tetraspan transmembrane protein-encoding superfamily . LHFPL1 is also known as LHFPL tetraspan subfamily member 1 .

Gene Information

LHFPL1, located on chromosome X, has several aliases and external identifiers :

  • Aliases: LHFPL1, lipoma HMGIC fusion partner-like 1, lipoma HMGIC fusion partner like 1, and LHFPL tetraspan subfamily member 1

  • HGNC: 6587

  • OMIM: 300566

  • MGI: 1891214

  • HomoloGene: 18653

  • GeneCards: LHFPL1

  • OMA: LHFPL1 - orthologs

  • KEGG: hsa:340596

  • STRING: 9606.ENSP00000361036

  • UniGene: Hs.297420

Protein Structure and Function

LHFPL1 belongs to the superfamily of tetraspan transmembrane proteins . It may regulate endothelial cell migration and tube formation and participate in assembling endothelial cell-cell junctions .

Expression

LHFPL1 is expressed in the ER of various tissues, particularly in the lung, thymus, skeletal muscle, colon, and ovary .

Functional Partners

Predicted functional partners of LHFPL1 include :

  • AMOT (Angiomotin)

  • RTL4 (Retrotransposon Gag-like protein 4)

  • LRCH2 (Leucine-rich repeat and calponin homology domain-containing protein 2)

  • UBE4B (Ubiquitin conjugation factor E4 B)

  • ALG13 (Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13)

  • LRRK1 (Leucine-rich repeat kinase 1)

  • TRPC5 (Short transient receptor potential channel 5)

  • HTR2C (5-hydroxytryptamine receptor 2C)

  • ANKRD40 (Ankyrin repeat domain 40)

  • ATRX (Transcriptional regulator ATRX)

These proteins interact with LHFPL1 and participate in various cellular processes, including tight junction maintenance, cognitive function, cytoskeleton organization, and transcriptional regulation .

Clinical Significance

Mutations in LHFP-like genes can cause deafness in humans and mice . Additionally, one LHFP-like gene can fuse with a high-mobility group gene in translocation-associated lipomas .

Antibodies

Many antibodies target LHFPL1, which are used in various research applications :

Antibody ProviderCatalog NumberAntibody TypeApplication(s)
Cusabio Biotech Co., LtdCSB-PA774822LA01HUPolyclonalELISA, ICC, IHC
antibodies-onlineABIN2489259PolyclonalWB, IHC
AbgentAP13197aPolyclonalWB
LSBioLS-C160046PolyclonalWB
Novus BiologicalsNBP1-91202PolyclonalIHC

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and confirmed in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
LHFPL1; UNQ5824/PRO19643; LHFPL tetraspan subfamily member 1 protein; Lipoma HMGIC fusion partner-like 1 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-220
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
LHFPL1
Target Protein Sequence
VTSSTSYFLPYWLFGSQMGKPVSFSTFRRCNYPVRGEGHSLIMVEECGRYASFNAIPSLA WQMCTVVTGAGCALLLLVALAAVLGCCMEELISRMMGRCMGAAQFVGGLLISSGCALYPL GWNSPEIMQTCGNVSNQFQLGTCRLGWAYYCAGGGAAAAMLICTWLSCFAGRNPKPVILV ESIMRNTNSYAMELDHCLKP
Uniprot No.

Target Background

Gene References Into Functions
  1. LHFPL1 exhibits widespread expression in the endoplasmic reticulum (ER) of all tissues, with particularly high levels observed in the lung, thymus, skeletal muscle, colon, and ovary. PMID: 15620218
  2. This publication provides a comprehensive overview of the LHFP gene family in mice and humans. PMID: 15905332
Database Links

HGNC: 6587

OMIM: 300566

KEGG: hsa:340596

STRING: 9606.ENSP00000361036

UniGene: Hs.297420

Protein Families
LHFP family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed. Expressed at high levels in lung, thymus, skeletal muscle, colon and ovary.

Q&A

What is LHFPL1 and what is its genomic organization?

LHFPL1 (Lipoma HMGIC Fusion Partner-Like 1) belongs to the LHFP gene family, which is a subset of the superfamily of tetraspan transmembrane protein encoding genes. The gene was mapped to Xq23 on the X chromosome in humans . In mice, the ortholog is located on the X chromosome as well .

LHFPL1 contains an open reading frame of 660 bp, encoding a protein with a signal peptide sequence and three transmembrane regions. The predicted molecular weight is approximately 23.7 kDa, which has been confirmed through prokaryotic expression systems .

How was the LHFP gene family first identified?

The LHFP gene family was first discovered during research on lipomas (benign fatty tumors). The original LHFP gene was isolated as a novel translocation partner of the HMGIC gene (now known as HMGA2) in a lipoma with t(12;13) translocation .

In the lipoma studied, the expressed HMGIC/LHFP fusion transcript encoded the three DNA binding domains of HMGIC followed by 69 amino acids encoded by frame-shifted LHFP sequences . This discovery established LHFP as the second identified translocation partner of HMGIC in lipomas and represented a candidate target gene for lipomas with 13q aberrations.

What is the tissue distribution pattern of LHFPL1?

LHFPL1 demonstrates widespread expression across multiple human tissues. RT-PCR amplification studies have revealed that LHFPL1 is expressed in all seventeen tested human tissues, with particularly high expression levels in:

Tissue TypeRelative Expression Level
LungHigh
ThymusHigh
Skeletal MuscleHigh
ColonHigh
OvaryHigh
Other tissuesModerate to low

Additionally, LHFPL1 is transcribed in six liver tumor cell lines, suggesting potential roles in both normal and pathological tissue contexts .

How does the structure of LHFPL1 relate to its function?

LHFPL1 encodes a protein with three transmembrane domains and a signal peptide sequence . The protein is postulated to be localized to the endoplasmic reticulum. This structural arrangement suggests LHFPL1 may function in:

  • Membrane signaling processes

  • Cell-cell communication

  • Transport of molecules across membranes

  • Maintenance of cellular architecture

While the precise function remains to be fully elucidated, its structural characteristics provide important clues about its potential cellular roles .

What methods are optimal for expressing and purifying recombinant LHFPL1?

Successful expression and purification of recombinant LHFPL1 requires careful consideration of several factors:

Expression Systems:

  • E. coli expression systems have been successfully used for LHFPL1 production . These provide high yields but may present challenges for proper folding of transmembrane domains.

  • Mammalian expression systems might be preferable for studying post-translational modifications and proper protein folding.

Purification Strategy:

  • For E. coli-expressed LHFPL1:

    • Inclusion body isolation followed by refolding

    • Detergent solubilization for membrane protein extraction

    • Affinity chromatography using histidine or other fusion tags

  • For mammalian-expressed LHFPL1:

    • Gentle membrane solubilization using appropriate detergents

    • Immunoprecipitation approaches

    • Size exclusion chromatography

When expressing transmembrane proteins like LHFPL1, careful optimization of detergent types and concentrations is critical for maintaining native conformation and function .

What is the relationship between LHFPL1 and HMGIC in tumor biology?

The LHFP gene family is directly linked to tumor biology through its relationship with HMGIC (HMGA2), particularly in lipomas:

  • Translocation Mechanisms: In lipomas with t(12;13) translocations, the LHFP gene acts as a fusion partner with HMGIC . This results in a fusion protein containing the DNA binding domains of HMGIC fused to partial LHFP sequences.

  • Functional Consequences: The HMGIC/LHFP fusion protein likely disrupts normal HMGIC function. HMGIC proteins are architectural transcription factors that regulate the expression of numerous genes through protein-DNA and protein-protein interactions .

  • Gene Expression Impact: The fusion event may alter target gene expression patterns, contributing to neoplastic transformation. HMGA proteins influence a diverse array of biological processes including cell growth, proliferation, differentiation, and death .

This relationship suggests LHFPL1 and related family members might play roles in tumor development through similar mechanisms, although direct evidence for LHFPL1's involvement is still being investigated .

How do LHFPL family proteins compare structurally and functionally?

The LHFPL family comprises several members with structural similarities but potentially diverse functions:

Family MemberChromosomal LocationKey FeaturesAssociated Conditions
LHFP13q (human)Original family memberLipomas with t(12;13)
LHFPL1Xq23 (human)3 transmembrane domainsUnder investigation
LHFPL2Multiple variantsLHFP-like protein 2Various potential roles
LHFPL37q22.2-q22.34 exonsAssociated with obesity, cognitive performance traits
LHFPL4(partial gene fragment)Corresponds to portion of LHFPL3Limited information

Notably, mutations in some LHFPL-like genes result in deafness in humans and mice, suggesting potential roles in auditory function . LHFPL family members appear to be part of a larger tetraspan transmembrane protein superfamily with diverse biological functions .

What experimental approaches are effective for studying LHFPL1 function?

Several methodological approaches have proven valuable for investigating LHFPL1:

  • Gene Expression Analysis:

    • RT-PCR amplification across tissues to determine expression patterns

    • Northern blot analysis to quantify transcript levels

    • RNA-seq to examine expression in different conditions

  • Protein Characterization:

    • Recombinant protein expression in prokaryotic systems

    • Western blotting for protein detection

    • ELISA-based quantification methods

  • Cellular Localization:

    • Immunofluorescence microscopy with tagged constructs

    • Subcellular fractionation techniques

    • Co-localization studies with endoplasmic reticulum markers

  • Functional Studies:

    • Gene knockdown/knockout approaches

    • Overexpression studies

    • Protein-protein interaction analyses

  • Genomic Analysis:

    • Chromosomal mapping techniques

    • Translocation analysis in tumor samples

    • Sequencing to identify mutations or variants

These approaches can be combined to build a comprehensive understanding of LHFPL1 biology .

How might LHFPL1 be involved in developmental processes?

Recent research suggests potential roles for LHFPL1 in developmental processes:

  • HMGA proteins, which interact with LHFP family members, are hardly detectable in normal adult tissue but are abundantly expressed during embryonic development, suggesting potential developmental roles for their interaction partners .

  • In a study examining tetrabromobisphenol A (TBBPA) effects on differentiating mouse embryonic cells, Lhfpl1 was identified among genes consistently differentially expressed across multiple time points and concentration conditions .

  • LHFPL1's widespread tissue expression pattern, particularly in developmental contexts, suggests potential roles in tissue differentiation and organizational processes .

  • The membrane-spanning nature of LHFPL1 positions it as a candidate for cell-cell communication processes that are critical during development .

While direct functional evidence is still emerging, these observations point to potential developmental roles worthy of further investigation .

What are the current challenges and future directions in LHFPL1 research?

Several significant challenges exist in LHFPL1 research:

  • Structural Complexity: As a transmembrane protein, LHFPL1 presents challenges for structural characterization using traditional methods. Advanced approaches like cryo-electron microscopy may provide new insights into its three-dimensional organization.

  • Functional Ambiguity: Despite genomic and expression data, the precise cellular functions of LHFPL1 remain largely undefined. Systematic functional screening approaches are needed.

  • Relevance to Human Disease: While other LHFPL family members have clear disease associations, LHFPL1's role in human pathologies requires further investigation.

Future research directions should focus on:

  • Generating comprehensive interactome maps for LHFPL1

  • Developing tissue-specific and inducible knockout models

  • Investigating potential roles in developmental disorders and cancer biology

  • Exploring LHFPL1 as a potential therapeutic target or biomarker

  • Comparative analysis across species to understand evolutionary conservation of function

Addressing these challenges will require multidisciplinary approaches combining molecular biology, genetics, structural biology, and bioinformatics techniques .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.