Recombinant Human Lipoma HMGIC fusion partner-like 2 protein (LHFPL2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human LHFPL2 Protein

Recombinant human LHFPL2 (lipoma HMGIC fusion partner-like 2) is a tetraspan transmembrane protein encoded by the LHFPL2 gene. It belongs to the LHFP (lipoma HMGIC fusion partner) gene family, which includes six members characterized by four transmembrane domains and roles in cellular signaling and differentiation . Native LHFPL2 is expressed in reproductive tissues, brain, and immune-related pathways, with mutations linked to infertility, hearing loss, and cancer progression . Recombinant LHFPL2 is engineered for research and therapeutic applications, enabling functional studies of its biological roles and potential drug-target validation.

Reproductive Health

LHFPL2 is critical for distal reproductive tract development. A spontaneous G102E mutation in mice causes:

  • Female infertility: Upper vaginal septum and lower vaginal agenesis.

  • Male infertility: Defects in seminal vesicle development .

  • Normal ovarian/uterine function: No impact on ovulation or estrogen response .

Cancer and Immune Modulation

In renal cell carcinoma (RCC), LHFPL2 is upregulated and correlates with:

ParameterAssociationSource
SurvivalPoor prognosis (OS, p = 0.017)
M2 MacrophagesPositive correlation with M2 polarization
Immune EvasionIncreased immune checkpoint expression (e.g., PD-1, CTLA-4)

Molecular Mechanisms

  • Hypoxia/angiogenesis: High LHFPL2 expression promotes tumor microenvironment remodelling.

  • Drug Targets: Conivaptan (vasopressin receptor antagonist) and nilotinib (tyrosine kinase inhibitor) show potential binding to LHFPL2 .

Biomarker Potential

LHFPL2 serves as a prognostic marker in RCC due to its correlation with:

  • Tumor staging: Higher expression in advanced/metastatic cases.

  • Immune cell infiltration: Negative association with activated NK cells .

Therapeutic Targets

Drug CandidateMechanismStatusSource
ConivaptanPotential LHFPL2 binding (molecular docking)Preclinical
NilotinibTyrosine kinase inhibition (off-target effect)FDA-approved

Future Directions

  1. Functional Studies: Elucidate LHFPL2’s role in M2 macrophage signaling and tumor immunity.

  2. Therapeutic Development: Validate FDA-approved drugs (e.g., nilotinib) for LHFPL2 inhibition in RCC.

  3. Diagnostic Tools: Develop assays using recombinant LHFPL2 for biomarker validation.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
LHFPL2; KIAA0206; LHFPL tetraspan subfamily member 2 protein; Lipoma HMGIC fusion partner-like 2 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-228
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
LHFPL2
Target Protein Sequence
MCHVIVTCRSMLWTLLSIVVAFAELIAFMSADWLIGKARSRGGVEPAGPGGGSPEPYHPT LGIYARCIRNPGVQHFQRDTLCGPYAESFGEIASGFWQATAIFLAVGIFILCMVALVSVF TMCVQSIMKKSIFNVCGLLQGIAGLFLILGLILYPAGWGCQKAIDYCGHYASAYKPGDCS LGWAFYTAIGGTVLTFICAVFSAQAEIATSSDKVQEEIEEGKNLICLL
Uniprot No.

Target Background

Function
LHFPL2 plays a crucial role in both female and male fertility and is involved in distal reproductive tract development.
Gene References Into Functions
  1. This study provides evidence of LHFPL2 and TPM1 variants with low allele frequencies and significant effects on the age of onset for familial Parkinson's disease. PMID: 27402877
  2. This publication offers a comprehensive overview of the LHFP gene family in mice and humans. PMID: 15905332
Database Links

HGNC: 6588

OMIM: 609718

KEGG: hsa:10184

STRING: 9606.ENSP00000369702

UniGene: Hs.670094

Protein Families
LHFP family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in all tissues and cell lines examined except brain and peripheral blood leukocytes.

Q&A

What is LHFPL2 and how is it structurally characterized?

LHFPL2 (Lipoma HMGIC Fusion Partner-Like 2) belongs to a protein family initially identified through its relationship with HMGIC (now known as HMGA2) gene rearrangements in lipomas. It encodes a tetra-transmembrane protein with largely unknown functions . The full-length human LHFPL2 cDNA encodes a protein of approximately 200 amino acids, which shows high conservation with its mouse ortholog . Sequence analysis indicates LHFPL2 is part of a protein family consisting of at least four to five members. The protein's transmembrane domains are critical for its function, as evidenced by the impact of the G102E missense mutation that affects a conserved amino acid residue .

What experimental approaches are recommended for studying LHFPL2 protein-protein interactions?

For studying LHFPL2 protein interactions, researchers should employ a combination of co-immunoprecipitation (co-IP) assays, yeast two-hybrid screening, and proximity ligation assays. When expressing recombinant LHFPL2, careful consideration must be given to maintaining the native conformation of the transmembrane domains. Detergent selection is critical - mild non-ionic detergents like DDM (n-dodecyl β-D-maltoside) or digitonin are recommended for membrane protein extraction while preserving protein-protein interactions. For confirmation of direct interactions, bioluminescence resonance energy transfer (BRET) or fluorescence resonance energy transfer (FRET) provides spatial resolution of <10nm to verify proximity in live cells. Cross-validation with multiple methods is essential given the technical challenges of working with multi-pass membrane proteins.

How does LHFPL2 relate to other members of the LHFP family?

LHFPL2 belongs to the LHFP (Lipoma HMGIC Fusion Partner) family, initially identified through the characterization of LHFP as a translocation partner of HMGIC in lipomas with t(12;13) . While sequence homology suggests functional similarity, each family member appears to have tissue-specific expression patterns. LHFPL2 shows particular enrichment in reproductive tract tissues, whereas other family members may predominate in different tissues . Phylogenetic analysis would be recommended to establish evolutionary relationships between family members, combined with comparative expression analysis across tissues. When investigating potentially redundant functions, researchers should consider compensatory upregulation of other family members in LHFPL2-knockout models, which could mask phenotypes in single-gene disruption studies.

What role does LHFPL2 play in reproductive tract development?

LHFPL2 has a critical role in the distal reproductive tract development of both females and males. Research has demonstrated that LHFPL2 is essential for the final merging phase of Müllerian ducts (female) and Wolffian ducts (male) with the urogenital sinus during embryonic development . In studies of mice with a spontaneous point mutation (G102E) in LHFPL2, examination at embryonic day 15.5 revealed that both Müllerian and Wolffian ducts had elongated normally but their duct tips were enlarged and failed to properly merge with the urogenital sinus . This finding establishes LHFPL2 as a key factor in a previously underappreciated "merging phase" of reproductive tract development, distinct from the well-characterized initiation, elongation, and differentiation phases. The protein appears to regulate cellular interactions at the interface between developing reproductive tracts and the urogenital sinus.

What experimental models are most effective for studying LHFPL2 in reproductive development?

For studying LHFPL2 in reproductive development, researchers should consider:

  • Mouse models with LHFPL2 mutations: The spontaneous G102E point mutation model has proven valuable for understanding LHFPL2 function . For more controlled studies, CRISPR/Cas9-generated knockout or knock-in models would allow precise evaluation of domain-specific functions.

  • Ex vivo organ culture systems: Explanted embryonic reproductive tracts can be maintained in culture to study the dynamics of duct elongation and merging in real-time, with the ability to manipulate LHFPL2 expression or function via viral vectors or small molecules.

  • 3D organoid cultures: Reproductive tract organoids derived from stem cells offer opportunities to recapitulate developmental processes in vitro while enabling precise genetic manipulation of LHFPL2.

  • Conditional knockout approaches: Tissue-specific and temporally-controlled LHFPL2 deletion using Cre-loxP systems can help distinguish between direct effects on reproductive tract development versus secondary effects from other tissues.

When designing these studies, researchers should prioritize temporal analysis of duct development with special focus on the merging phase around embryonic day 15.5 in mice, as this appears to be the critical period for LHFPL2 function .

What reproductive abnormalities result from LHFPL2 mutations and how can they be characterized?

LHFPL2 mutations result in distinct reproductive abnormalities in females and males:

In females with the G102E mutation:

  • 100% infertility

  • Normal ovarian development and ovulation

  • Normal uterine development and response to estrogen

  • Abnormal upper longitudinal vaginal septum

  • Lower vaginal agenesis

In males with the G102E mutation:

  • ~70% infertility

  • Normal mating behavior and sperm counts

  • Abnormal distal vas deferens convolution

  • Complete reproductive tract blockage in infertile males

  • Incomplete blockage in fertile males

For characterization, researchers should employ:

  • Histological analysis with reproductive tract-specific markers

  • Micro-CT or MRI for 3D visualization of tract anatomy

  • Functional tests including dye injection studies to assess reproductive tract patency

  • Electron microscopy to examine cellular junctions and epithelial organization

  • Lineage tracing to monitor duct development in real-time during embryogenesis

How is LHFPL2 involved in tumor microenvironment regulation?

LHFPL2 has emerged as a significant regulator of the tumor microenvironment, particularly through its influence on macrophage polarization. In renal cell carcinoma (RCC), LHFPL2 is upregulated and associated with poor survival outcomes . Comprehensive analysis of transcriptomic data from 609 KIRC (Kidney Renal Clear Cell Carcinoma) patients and single-cell sequencing data from 34,326 renal carcinoma cells revealed that LHFPL2 expression is positively correlated with M2 macrophage infiltration . The high-LHFPL2 expression subgroup exhibited enhanced M2 polarization, increased hypoxia signaling, immune evasion, and elevated angiogenesis scores . These factors collectively promote tumor progression through the creation of an immunosuppressive microenvironment. The specific mechanism appears to involve LHFPL2's role in regulating macrophage function, potentially through transmembrane signaling that influences polarization toward the pro-tumorigenic M2 phenotype.

What methodologies are recommended for studying LHFPL2 in tumor samples?

For comprehensive analysis of LHFPL2 in tumor samples, researchers should employ a multi-omics approach:

  • Expression analysis:

    • RNA-seq for transcriptome-wide analysis

    • Single-cell RNA-seq to identify cell type-specific expression patterns

    • Spatial transcriptomics to understand expression in the context of tumor architecture

  • Protein detection:

    • Multiplex immunohistochemistry to co-localize LHFPL2 with macrophage markers (CD68, CD163)

    • Mass cytometry (CyTOF) for high-dimensional protein profiling

    • Proximity extension assays for protein interaction networks

  • Functional studies:

    • CRISPR-mediated knockout in tumor cell lines and co-culture with macrophages

    • Conditional knockdown using inducible shRNA systems

    • Patient-derived xenografts with LHFPL2 manipulation

  • Bioinformatic approaches:

    • Correlation analysis with immune cell signatures

    • Gene set enrichment analysis focusing on macrophage polarization pathways

    • Survival analysis stratified by LHFPL2 expression levels

Integration of these methodologies provides a comprehensive understanding of LHFPL2's role in the tumor microenvironment and its relationship to clinical outcomes.

What is the relationship between LHFPL2 expression and macrophage M2 polarization in cancer?

Research has established a significant positive correlation between LHFPL2 expression and M2 macrophage polarization in cancer. Analysis of RCC data demonstrated that LHFPL2 expression is specifically elevated in macrophages within the tumor microenvironment . High LHFPL2 expression correlates with increased expression of M2-related genes and markers of immune checkpoint pathways .

Table 1: Correlation between LHFPL2 expression and immune-related markers in RCC

ParameterCorrelation with LHFPL2Statistical significance
M2 macrophage infiltrationStrong positivep < 0.001
Immune checkpoint genesPositivep < 0.001
Activated NK cellsNegativep < 0.05
M2 polarization scoreStrong positivep < 0.001
Hypoxia signalingPositivep < 0.001
Angiogenesis scorePositivep < 0.001

These findings suggest LHFPL2 may serve as a potential biomarker for M2 polarization of macrophages in tumors and could represent a therapeutic target for reprogramming the tumor immune microenvironment . Mechanistically, LHFPL2 might influence signaling pathways that drive alternative activation of macrophages, though the precise molecular mechanisms require further elucidation.

How does the LHFPL2-HMGA2 fusion contribute to tumor development?

The LHFPL2-HMGA2 (previously HMGIC) fusion represents an important mechanism in the pathogenesis of certain benign tumors, particularly lipomas. In this context, LHFP (Lipoma HMGIC Fusion Partner), closely related to LHFPL2, was originally identified as a translocation partner of HMGIC in a lipoma with t(12;13) . The expressed HMGIC/LHFP fusion transcript typically encodes the three DNA binding domains of HMGIC followed by 69 amino acids encoded by frame-shifted LHFP sequences . Similar fusion events may occur with LHFPL2.

The molecular consequence of such fusions appears to be the separation of HMGA2's DNA-binding domains from its regulatory C-terminal domain, resulting in a chimeric protein with altered transcriptional regulatory properties. This fusion event likely contributes to tumorigenesis through:

  • Disruption of normal HMGA2 regulation

  • Introduction of novel protein domains from LHFPL2/LHFP that may alter target specificity

  • Changes in subcellular localization of the fusion protein

  • Potential dominant-negative effects on wild-type HMGA2 function

Researchers investigating these fusion proteins should employ chromatin immunoprecipitation sequencing (ChIP-seq) to identify altered DNA binding patterns and RNA-seq to characterize downstream transcriptional effects.

What protein domains of LHFPL2 are critical for its biological functions?

Based on the available research, several domains appear critical for LHFPL2 function:

  • Transmembrane domains: LHFPL2 contains four transmembrane domains characteristic of this protein family. The spontaneous G102E mutation that causes reproductive tract defects occurs within one of these domains, suggesting their importance for proper protein function .

  • N-terminal proline-rich domain: Analysis of LPP-HMGA2 fusion variants in lipomas indicated that the N-terminal proline-rich domain might be functionally important, as it was preserved across different fusion variants .

  • Extracellular loops: These regions likely mediate interactions with extracellular ligands or adjacent cell membranes, particularly important during the merging phase of reproductive tract development.

  • Cytoplasmic domains: These regions potentially interact with intracellular signaling molecules that influence cellular processes such as macrophage polarization.

When designing experiments to study domain-specific functions, researchers should consider:

  • Domain-specific deletion constructs

  • Point mutations of conserved residues

  • Domain-swapping experiments with related family members

  • Structural studies (e.g., cryo-EM) to determine three-dimensional organization

What signaling pathways does LHFPL2 interact with or influence?

While the complete signaling network of LHFPL2 remains to be fully elucidated, several pathways appear to be influenced by this protein:

  • Hypoxia signaling: In RCC, high LHFPL2 expression correlates with increased hypoxia signaling , suggesting potential interaction with the HIF-1α pathway, a key regulator of cellular response to oxygen limitation.

  • Immune checkpoint regulation: LHFPL2 expression positively correlates with various immune checkpoint genes , indicating potential involvement in pathways that regulate T-cell activation and exhaustion.

  • Angiogenesis pathways: High LHFPL2 expression is associated with elevated angiogenesis scores , suggesting influence on VEGF signaling or other pro-angiogenic pathways.

  • Macrophage polarization pathways: LHFPL2's strong correlation with M2 polarization suggests involvement in IL-4/IL-13 signaling, STAT6 activation, or other pathways that drive alternative macrophage activation.

For studying these pathway interactions, researchers should consider phosphoproteomic analysis following LHFPL2 manipulation, pathway inhibitor studies to identify epistatic relationships, and co-immunoprecipitation followed by mass spectrometry to identify direct interaction partners.

How can LHFPL2 be targeted for potential therapeutic applications in cancer?

Based on emerging research on LHFPL2's role in cancer progression, several therapeutic approaches could be considered:

  • Small molecule inhibitors: Molecular docking studies have identified potential FDA-approved drugs that may target LHFPL2, including conivaptan and nilotinib . These compounds should be tested for their binding affinity and functional effects on LHFPL2.

  • Biologics targeting LHFPL2: Monoclonal antibodies or recombinant proteins that bind to the extracellular domains of LHFPL2 could potentially modulate its function. This approach would be particularly relevant if LHFPL2 interacts with extracellular ligands.

  • RNA interference strategies: siRNA or antisense oligonucleotides targeting LHFPL2 mRNA could reduce its expression in tumors. Nanoparticle delivery systems with macrophage-targeting capabilities would enhance specificity.

  • Macrophage reprogramming: Since LHFPL2 appears to promote M2 polarization, inhibiting its function might shift the balance toward M1 anti-tumor macrophages. This could potentially enhance immunotherapy efficacy.

Researchers should approach these therapeutic strategies with careful consideration of LHFPL2's normal physiological roles, particularly in reproductive tissues, to minimize potential side effects.

What are the most significant challenges in studying LHFPL2 protein structure and function?

Researchers face several significant challenges when studying LHFPL2:

  • Membrane protein expression and purification: As a tetra-transmembrane protein, LHFPL2 presents technical challenges for recombinant expression and purification while maintaining native conformation. Specialized expression systems such as insect cells or mammalian cells are recommended over bacterial systems.

  • Structural determination: Membrane proteins are notoriously difficult for structural studies. Cryo-EM may offer advantages over crystallography for LHFPL2, particularly when combined with nanodiscs to maintain the membrane environment.

  • Functional redundancy: LHFPL2 belongs to a family with multiple members, potentially leading to compensatory mechanisms in knockout models. Consider combinatorial knockouts or acute protein degradation approaches (e.g., PROTAC technology).

  • Tissue-specific functions: LHFPL2 appears to have distinct roles in reproductive tissues and immune cells, necessitating tissue-specific analytical approaches. Single-cell analyses are particularly valuable for resolving this complexity.

  • Temporal dynamics: Developmental roles of LHFPL2 may be highly stage-specific, requiring precise temporal control in experimental systems. Inducible gene manipulation strategies are recommended.

How can researchers effectively use bioinformatic approaches to study LHFPL2 across different datasets?

For comprehensive bioinformatic analysis of LHFPL2, researchers should implement the following strategies:

  • Multi-omics data integration:

    • Combine transcriptomic, proteomic, and epigenomic datasets to construct a holistic view of LHFPL2 regulation and function

    • Utilize tools like MultiPLIER or MOFA for integrated analysis

    • Apply network-based approaches to identify functional modules containing LHFPL2

  • Cross-species comparative analysis:

    • Leverage evolutionary conservation to identify functionally important domains

    • Compare expression patterns across species to identify conserved regulatory mechanisms

    • Use synteny analysis to understand genomic context conservation

  • Single-cell data analysis:

    • Apply trajectory inference methods to understand LHFPL2's role in cellular differentiation

    • Use cell-cell communication inference tools (e.g., CellPhoneDB, NicheNet) to identify potential intercellular signaling roles

    • Integrate spatial transcriptomics data to add tissue context

  • Clinical correlation analysis:

    • Stratify patient cohorts by LHFPL2 expression levels for survival analysis

    • Perform multivariate analysis to control for confounding factors

    • Implement machine learning approaches to identify predictive signatures incorporating LHFPL2

Table 2: Key bioinformatic resources for LHFPL2 research

Resource typeRecommended toolsApplication
Gene expression databasesGTEx, TCGA, GEOTissue-specific expression patterns
Protein interaction databasesSTRING, BioGRID, IntActIdentifying interaction networks
Single-cell databasesHuman Cell Atlas, Tabula MurisCell type-specific expression
Pathway analysisReactome, KEGG, MSigDBFunctional context
Structural predictionAlphaFold, RoseTTAFoldProtein structure modeling

Implementing these bioinformatic approaches will provide a comprehensive understanding of LHFPL2 function across different biological contexts.

What are the optimal conditions for expressing and purifying recombinant LHFPL2 protein?

For successful expression and purification of functional recombinant LHFPL2, researchers should consider the following optimized protocol:

  • Expression system selection:

    • Mammalian expression systems (HEK293F, CHO) are preferred for maintaining proper folding and post-translational modifications

    • Insect cell systems (Sf9, High Five) offer an alternative with higher yield potential

    • Avoid bacterial systems which typically fail to properly fold multi-pass membrane proteins

  • Construct design:

    • Include a cleavable, affinity tag (e.g., His8, Twin-Strep) at either N- or C-terminus

    • Consider fusion partners like GFP to monitor expression and folding

    • Add consensus glycosylation sites if native sites are unknown

    • Test multiple constructs with varying N- and C-terminal boundaries

  • Membrane extraction:

    • Screen detergents systematically: start with mild detergents (DDM, LMNG, GDN)

    • Consider lipid nanodiscs or SMALPs for native-like membrane environment

    • Use detergent exchange during purification to find optimal stability conditions

  • Purification strategy:

    • Two-step affinity chromatography followed by size exclusion chromatography

    • Maintain detergent above critical micelle concentration throughout

    • Include lipids (e.g., cholesterol, POPC) in buffers to enhance stability

    • Consider thermal stability assays to optimize buffer conditions

  • Quality control:

    • SEC-MALS to confirm monodispersity and molecular weight

    • Negative-stain EM to assess homogeneity

    • Functional assays specific to hypothesized LHFPL2 activity

This optimized approach maximizes the likelihood of obtaining functional recombinant LHFPL2 suitable for structural and biochemical studies.

What are the best techniques for detecting LHFPL2 gene and protein expression in different tissue types?

For comprehensive analysis of LHFPL2 expression across tissues, researchers should employ a multi-modal approach:

For mRNA detection:

  • qRT-PCR: Design primers spanning exon junctions to avoid genomic DNA amplification. Include multiple reference genes specific to the tissue being studied.

  • RNA in situ hybridization: RNAscope technology offers single-molecule sensitivity with spatial resolution. Design probes targeting less conserved regions to avoid cross-reactivity with other LHFPL family members.

  • Single-cell RNA-seq: Provides cell type-specific expression profiles. Consider using Smart-seq2 for full-length coverage or 10x Genomics for higher throughput.

For protein detection:

  • Immunohistochemistry/Immunofluorescence: Validate antibodies rigorously using LHFPL2-knockout tissues as negative controls. Consider multiplexed immunofluorescence to co-localize with cell type-specific markers.

  • Western blotting: Use membrane protein extraction protocols optimized for multi-pass membrane proteins (e.g., including cholesterol-destabilizing agents). Include positive controls from tissues known to express LHFPL2.

  • Mass spectrometry: For unbiased detection, employ targeted proteomics approaches like parallel reaction monitoring (PRM) or selected reaction monitoring (SRM) for higher sensitivity when detecting LHFPL2 peptides.

For localization studies:

  • Super-resolution microscopy: Techniques like STORM or PALM can resolve subcellular localization beyond the diffraction limit.

  • Proximity labeling: BioID or APEX2 fusion proteins can identify proteins in close proximity to LHFPL2 in living cells.

When interpreting results, consider tissue-specific post-translational modifications that may affect detection, and always validate findings using multiple independent techniques.

How can researchers develop effective knockout or knockdown models to study LHFPL2 function?

To develop effective genetic models for studying LHFPL2 function, researchers should consider these methodological approaches:

CRISPR/Cas9-based knockout strategies:

  • Complete knockout: Design gRNAs targeting early exons to induce frameshift mutations. Verify knockout by sequencing and Western blotting.

  • Conditional knockout: Implement floxed alleles (loxP sites flanking critical exons) combined with tissue-specific Cre recombinase expression for spatial control. Tamoxifen-inducible CreERT2 systems provide additional temporal control.

  • Domain-specific editing: Use precise gene editing to introduce point mutations (e.g., G102E) or delete specific domains to dissect structure-function relationships.

RNA interference approaches:

  • shRNA: For stable knockdown, use inducible promoters (e.g., Tet-On) to control expression timing and degree.

  • siRNA: For transient knockdown, optimize delivery methods according to target tissue (e.g., lipid nanoparticles for macrophages).

  • Antisense oligonucleotides: Consider GapmeRs for efficient knockdown in difficult-to-transfect primary cells.

Functional validation:

  • Rescue experiments: Reintroduce wild-type or mutant LHFPL2 to confirm phenotype specificity and study structure-function relationships.

  • Assess compensatory mechanisms: Monitor expression of other LHFPL family members that might compensate for LHFPL2 loss.

  • Temporal analysis: For developmental phenotypes, implement time-course studies to determine critical periods of LHFPL2 function.

Table 3: Comparison of genetic manipulation strategies for LHFPL2

MethodAdvantagesLimitationsBest application
CRISPR/Cas9 knockoutComplete protein eliminationPotential developmental lethalityMechanistic studies
Conditional knockoutTissue-specific analysisComplex breeding schemesDevelopmental studies
Inducible shRNATemporal control, partial knockdownVariable efficiencyAdult tissue studies
siRNARapid implementationTransient effectIn vitro studies
Point mutationsStructure-function insightsLabor-intensive validationDomain function analysis

The optimal approach depends on the specific research question, with consideration for potential developmental roles of LHFPL2 that might necessitate conditional systems.

How can LHFPL2 research contribute to understanding infertility and reproductive disorders?

LHFPL2 research offers significant insights into previously uncharacterized mechanisms of reproductive tract development and related disorders:

  • Novel developmental mechanisms: LHFPL2 has revealed a critical "merging phase" in reproductive tract development, where the distal ends of Müllerian/Wolffian ducts must properly connect with the urogenital sinus . This represents a new developmental checkpoint distinct from the well-characterized initiation, elongation, and differentiation phases.

  • Genetic basis for congenital abnormalities: The LHFPL2 G102E mutation results in specific reproductive tract malformations including vaginal septum and agenesis in females, and vas deferens convolution in males . These findings suggest LHFPL2 could be a candidate gene for unexplained cases of:

    • Müllerian anomalies (vaginal septa, vaginal agenesis)

    • Obstructive azoospermia with normal sperm production

    • Unexplained infertility with normal gonadal function

  • Diagnostic applications: Screening for LHFPL2 mutations or expression abnormalities could identify previously undiagnosed causes of reproductive tract anomalies. Researchers should develop sensitive genetic panels that include LHFPL2 alongside other reproductive development genes.

  • Therapeutic implications: Understanding LHFPL2's role in tissue fusion events could inform surgical approaches for correcting reproductive tract abnormalities, or potentially guide tissue engineering strategies for reproductive tract reconstruction.

For clinical translation, researchers should conduct genetic association studies in patients with unexplained reproductive tract anomalies, particularly those affecting the distal portions of the reproductive tracts.

What are the implications of LHFPL2's role in macrophage polarization for immunotherapy research?

LHFPL2's emerging role in macrophage polarization has significant implications for cancer immunotherapy:

  • Biomarker potential: LHFPL2 expression correlates with M2 macrophage polarization and poor outcomes in renal cell carcinoma . This suggests LHFPL2 could serve as a predictive biomarker for:

    • Immunotherapy response/resistance

    • Tumor immune microenvironment classification

    • Patient stratification for targeted therapies

  • Therapeutic targeting: Inhibiting LHFPL2 function could potentially reprogram tumor-associated macrophages from immunosuppressive M2 to pro-inflammatory M1 phenotypes, which could:

    • Enhance T cell-based immunotherapy efficacy

    • Overcome resistance to immune checkpoint inhibitors

    • Reduce immunosuppression in the tumor microenvironment

  • Combination therapy rationale: The identification of FDA-approved drugs like conivaptan and nilotinib as potential LHFPL2 inhibitors provides a foundation for rational drug repurposing in combination with established immunotherapies.

  • Mechanism-based patient selection: High LHFPL2 expression correlates with immune evasion signatures , suggesting patients with high tumor LHFPL2 expression might particularly benefit from approaches targeting this pathway.

When designing immunotherapy studies incorporating LHFPL2, researchers should:

  • Monitor both LHFPL2 expression and macrophage polarization markers

  • Assess changes in the broader immune microenvironment beyond macrophages

  • Establish clear pharmacodynamic markers of successful LHFPL2 targeting

How does translational LHFPL2 research differ between reproductive biology and cancer biology applications?

Translational LHFPL2 research differs significantly between reproductive and cancer contexts in multiple dimensions:

Research models:

  • Reproductive biology: Focuses on developmental models (embryonic mice, organoids) with emphasis on structural outcomes and long-term developmental consequences .

  • Cancer biology: Utilizes tumor models with emphasis on immune cell interactions, particularly macrophage function in the tumor microenvironment .

Temporal considerations:

  • Reproductive biology: Critical LHFPL2 function occurs during specific embryonic developmental windows, requiring precise temporal analysis .

  • Cancer biology: LHFPL2 influences ongoing processes in the adult tumor microenvironment, requiring dynamic analysis of immune responses .

Therapeutic approaches:

  • Reproductive biology: Potential interventions would focus on genetic screening, counseling, or surgical corrections for developmental anomalies.

  • Cancer biology: Interventions aim to modulate LHFPL2 function pharmacologically to reprogram the tumor immune microenvironment.

Outcome measures:

Despite these differences, researchers should consider integrating insights across fields, as LHFPL2's transmembrane signaling functions likely share common molecular mechanisms despite different tissue contexts and developmental timing.

What are the most promising unresolved questions about LHFPL2 function?

Several critical questions about LHFPL2 function remain unresolved and represent promising research directions:

  • Molecular signaling mechanisms: How does LHFPL2, as a transmembrane protein, transduce signals across cell membranes? Does it function as a receptor, co-receptor, or channel? What are its physiological ligands or binding partners?

  • Tissue-specific roles: What explains LHFPL2's distinct functions in reproductive tract development versus immune regulation? Does it interact with different partners in different cellular contexts?

  • Structural determinants of function: Which specific protein domains mediate LHFPL2's various functions? How does the G102E mutation disrupt function at the molecular level?

  • Evolutionary conservation: How conserved is LHFPL2 function across species, and what does this reveal about its fundamental biological importance?

  • Relationship to other LHFPL family members: Do other family members have redundant functions? What explains their divergent tissue expression patterns and functional specialization?

Addressing these questions will require integrative approaches combining structural biology, genetic manipulation, cell biology, and systems-level analysis. Particular emphasis should be placed on identifying LHFPL2 interaction partners in different cellular contexts, as these likely mediate its diverse biological functions.

How might single-cell and spatial transcriptomics advance LHFPL2 research?

Single-cell and spatial transcriptomic technologies offer powerful new approaches to understand LHFPL2 function:

  • Cell type-specific expression profiling:

    • Single-cell RNA-seq can identify specific cell populations expressing LHFPL2 with unprecedented resolution

    • This approach has already revealed LHFPL2's specific expression in macrophages within the tumor microenvironment

    • Future studies should extend to reproductive tract development to identify exact cell types expressing LHFPL2 during the critical merging phase

  • Spatial context analysis:

    • Spatial transcriptomics technologies (e.g., Visium, MERFISH, Slide-seq) can map LHFPL2 expression within tissue architecture

    • Particularly valuable for understanding LHFPL2's role at tissue boundaries and fusion points during reproductive tract development

    • Can reveal spatial relationships between LHFPL2-expressing cells and other cell types in both developmental and tumor contexts

  • Trajectory analysis:

    • Pseudotime analysis of single-cell data can reconstruct developmental or polarization trajectories

    • Could reveal how LHFPL2 expression changes during macrophage polarization or reproductive tract epithelial differentiation

    • Regulatory network inference from these data could identify upstream regulators of LHFPL2

  • Multi-modal analysis:

    • Combined protein and RNA analysis (e.g., CITE-seq) can correlate LHFPL2 transcript levels with surface protein markers

    • Multi-omic approaches integrating chromatin accessibility could reveal regulatory mechanisms controlling LHFPL2 expression

These technologies will likely reveal previously unappreciated heterogeneity in LHFPL2-expressing cells and provide context-specific insights into its function within complex tissues.

What interdisciplinary approaches could accelerate discoveries about LHFPL2?

Accelerating LHFPL2 research requires interdisciplinary approaches that bridge multiple scientific domains:

  • Structural biology and biochemistry:

    • Cryo-EM studies of LHFPL2 in membrane environments

    • Hydrogen-deuterium exchange mass spectrometry to map conformational changes

    • Lipid interaction studies to understand membrane environment requirements

  • Systems biology and computational modeling:

    • Network analysis to place LHFPL2 in broader signaling contexts

    • Machine learning approaches to predict functional interactions

    • Integrative multi-omics data analysis across tissues and conditions

  • Developmental biology and organoid technology:

    • Advanced reproductive tract organoid models

    • Intravital imaging of developing reproductive tracts

    • Microfluidic organ-on-chip systems modeling tissue interfaces

  • Immunology and cancer biology:

    • Macrophage-tumor co-culture systems with LHFPL2 manipulation

    • In vivo models combining LHFPL2 modulation with immunotherapy

    • Mechanistic studies of macrophage polarization signaling

  • Clinical research and translational medicine:

    • Genetic screening in patients with reproductive abnormalities

    • Biomarker studies in cancer immunotherapy cohorts

    • Drug development targeting LHFPL2 for cancer applications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.