Recombinant Human Lipoma HMGIC fusion partner-like 4 protein (LHFPL4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your required tag type for preferential development.
Synonyms
LHFPL4; GARLH4; LHFPL tetraspan subfamily member 4 protein; GABAA receptor regulatory Lhfpl4; Lipoma HMGIC fusion partner-like 4 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
LHFPL4
Target Protein Sequence
MLPSQEASKLYHEHYMRNSRAIGVLWAIFTICFAIINVVVFIQPYWVGDSVSTPKPGYFG LFHYCVGSGLAGRELTCRGSFTDFSTIPSSAFKAAAFFVLLSMVLILGCITCFSLFFFCN TATVYKICAWMQLLAALCLVLGCMIFPDGWDAETIRDMCGAKTGKYSLGDCSVRWAYILA IIGILNALILSFLAFVLGNRQTDLLQEELKPENKDFVGSTVSSVLRPGGDVSGWGVLPCP VAHSQGP
Uniprot No.

Target Background

Function
This protein plays a crucial role in regulating inhibitory synapse formation and function. It contributes to maintaining the clustering of gamma-aminobutyric acid receptors (GABAARs) and associated scaffold proteins at inhibitory synaptic sites. It functions in concert with NLGN2 to recruit or stabilize GABAARs.
Gene References Into Functions
  1. Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) PMID: 20379614
  2. Overview of the LHFP gene family in mouse and humans. PMID: 15905332
Database Links

HGNC: 29568

OMIM: 610240

KEGG: hsa:375323

STRING: 9606.ENSP00000287585

UniGene: Hs.56782

Protein Families
LHFP family
Subcellular Location
Cell projection, dendrite. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein.

Q&A

What is LHFPL4 and which gene family does it belong to?

LHFPL4 (Lipoma HMGIC Fusion Partner-Like 4) is a protein-coding gene that belongs to the lipoma HMGIC fusion partner (LHFP) gene family, which is a subset of the superfamily of tetraspan transmembrane protein encoding genes. It is also known as GARLH4 in scientific literature. This gene is part of a family where other members have been associated with conditions such as deafness in humans and mice, and another LHFP-like gene has been identified in translocation-associated lipomas fused to high-mobility group genes .

Where is the LHFPL4 gene located in the human genome?

The LHFPL4 gene is located on chromosome 3p25.3 in the human genome. Specifically, it can be found on chromosome 3 at positions 9,498,361 to 9,553,822 on the complementary strand (NC_000003.12). The gene consists of 5 exons in total, which code for the functional LHFPL4 protein .

What is the cellular localization and primary function of LHFPL4?

LHFPL4 is selectively enriched at inhibitory synapses in neurons. Using confocal and structured illumination microscopy, researchers have demonstrated that LHFPL4 forms discrete membrane clusters on the soma and dendrites that colocalize with the inhibitory postsynaptic marker gephyrin, positioned adjacent to vesicular GABA transporter (VGAT)-labeled inhibitory presynaptic terminals. LHFPL4 is approximately 6-fold more enriched at inhibitory compared to excitatory synapses. Functionally, LHFPL4 plays a critical role in regulating postsynaptic GABA-A receptor (GABA-AR) clustering in hippocampal pyramidal neurons, serving as an essential component for maintaining proper inhibitory synaptic transmission .

How does LHFPL4 interact with GABA-A receptors?

LHFPL4 forms high-affinity interactions with GABA-A receptor subunits. Co-immunoprecipitation experiments have shown that LHFPL4 can readily interact with multiple GABA-AR subunits including α1, α2, β3, and γ2. These interactions occur directly and do not require other neuronally expressed synaptic proteins such as gephyrin. The robust interaction between LHFPL4 and GABA-AR subunits appears to be crucial for the proper synaptic targeting and clustering of these receptors at inhibitory synapses .

What other synaptic proteins interact with LHFPL4?

Beyond its interactions with GABA-A receptors, LHFPL4 forms native complexes with other key components of the inhibitory postsynaptic scaffold. Co-immunoprecipitation experiments from brain lysates have revealed that LHFPL4 interacts with gephyrin, the main scaffolding protein at inhibitory synapses, and neuroligin2, an inhibitory postsynaptic adhesion molecule. These interactions suggest that LHFPL4 is integrated into a larger molecular complex at inhibitory synapses that collectively regulates inhibitory synapse formation, maintenance, and function .

How can LHFPL4-GABA-A receptor interactions be studied experimentally?

Researchers can study LHFPL4-GABA-A receptor interactions through various experimental approaches:

  • Co-immunoprecipitation: Using antibodies against LHFPL4 or GABA-AR subunits to pull down protein complexes from brain lysates or transfected cell lines, followed by western blotting to detect interacting partners.

  • Fluorescence microscopy: Expressing fluorescently tagged LHFPL4 (e.g., GFP-tagged) in neurons and co-labeling with antibodies against GABA-AR subunits and other synaptic markers to assess colocalization.

  • Super-resolution microscopy: Techniques such as structured illumination microscopy (SIM) can reveal nanoscale organization of LHFPL4 and GABA-ARs at synapses.

  • Surface receptor labeling: Using antibodies against extracellular epitopes of GABA-AR subunits in non-permeabilized cells to specifically identify surface-expressed receptors and their colocalization with LHFPL4 .

What happens to inhibitory synapses when LHFPL4 is deleted?

When LHFPL4 is deleted, there are dramatic effects on inhibitory synapses, particularly in excitatory hippocampal pyramidal neurons:

  • Loss of GABA-AR clustering: A significant reduction in GABA-AR surface clusters at synaptic sites is observed.

  • Disruption of gephyrin scaffold: There is a marked decrease in gephyrin clustering at inhibitory synapses, with the formation of large intracellular gephyrin aggregates within the soma and dendrites.

  • Reduced inhibitory postsynaptic currents: The loss of synaptic GABA-ARs results in a profound reduction in fast inhibitory synaptic transmission.

  • Intact receptor trafficking but impaired synaptic targeting: GABA-ARs can still reach the cell surface in LHFPL4 knockout neurons but are no longer properly anchored at synaptic sites, resulting in a more diffuse distribution.

  • Preserved presynaptic terminals: Despite the postsynaptic defects, inhibitory presynaptic terminals labeled by VGAT remain intact, indicating a specific effect on the postsynaptic apparatus .

Is LHFPL4 function cell-type specific in the brain?

Yes, LHFPL4 demonstrates remarkable cell-type specificity in its function. In the hippocampus, LHFPL4 deletion affects GABA-AR clustering and inhibitory synaptic transmission specifically in excitatory pyramidal neurons while sparing inhibitory interneurons. This was demonstrated by comparing the effect of LHFPL4 deletion on GABA-AR-γ2 clustering in CAMKIIα-positive (excitatory) versus GAD6-positive (inhibitory) neurons. This cell-type specificity suggests that different mechanisms may regulate inhibitory synapse formation and maintenance in different neuronal populations, with LHFPL4 being specifically required in excitatory cells .

How does LHFPL4 knockout affect inhibitory synaptic transmission?

The deletion of LHFPL4 leads to a profound reduction in fast inhibitory postsynaptic currents in hippocampal pyramidal neurons. This electrophysiological phenotype is consistent with the observed loss of synaptic GABA-A receptors, which are essential for mediating inhibitory neurotransmission. The functional impact is cell-type specific, with excitatory pyramidal neurons showing deficits while inhibitory interneuron currents remain unaffected. This selective effect on inhibitory transmission in excitatory neurons may have important implications for understanding the balance of excitation and inhibition in neural circuits and potentially for disorders where this balance is disrupted .

What recombinant expression systems are effective for studying LHFPL4?

For recombinant expression of LHFPL4, researchers can utilize several expression systems:

  • Mammalian expression in HEK293 or COS-7 cells: These cell lines have been successfully used to express tagged versions of LHFPL4 (such as GFP-tagged or turbo-GFP-tagged LHFPL4) for biochemical studies and co-expression with GABA-AR subunits.

  • Neuronal expression: Transfection of cultured hippocampal neurons with LHFPL4 constructs allows for the study of its localization and function in a native neuronal environment.

  • Viral vector-based expression: For in vivo studies or high-efficiency transduction of neurons, lentiviral or adeno-associated viral vectors carrying LHFPL4 can be employed.

When expressing recombinant LHFPL4, researchers should consider including appropriate epitope tags (GFP, FLAG, HA) to facilitate detection and purification while ensuring that these tags do not interfere with protein folding or function .

What are effective methods for detecting endogenous LHFPL4 in brain tissue?

Detecting endogenous LHFPL4 in brain tissue can be achieved through several approaches:

  • Immunohistochemistry/immunofluorescence: Using LHFPL4-specific antibodies on fixed brain sections or cultured neurons can reveal the native distribution of LHFPL4 at inhibitory synapses when co-labeled with markers like gephyrin and VGAT.

  • Western blotting: For detection of LHFPL4 protein in brain lysates, western blotting with specific antibodies can determine expression levels across different brain regions or developmental stages.

  • Co-immunoprecipitation: To study native protein complexes containing LHFPL4, co-immunoprecipitation from brain lysates followed by western blotting can identify interacting partners.

  • In situ hybridization: For mRNA detection, in situ hybridization with LHFPL4-specific probes can reveal the regional and cellular expression pattern of the gene .

What approaches can be used to study LHFPL4 function in neurons?

Several experimental approaches can be employed to investigate LHFPL4 function in neurons:

  • Genetic knockout models: LHFPL4 knockout mice provide a powerful tool to study the consequences of complete LHFPL4 deletion on inhibitory synapse structure and function.

  • RNA interference: Short hairpin RNA (shRNA) or siRNA targeting LHFPL4 can be used for acute knockdown in cultured neurons or in vivo.

  • Expression of dominant-negative constructs: Truncated or mutated versions of LHFPL4 that may interfere with normal function can help dissect its mechanistic roles.

  • Live imaging with pH-sensitive fluorescent tags: Super-ecliptic pHluorin (SEP)-tagged GABA-AR subunits can be used to specifically visualize surface expression and dynamics of receptors in the presence or absence of LHFPL4.

  • Electrophysiological recordings: Patch-clamp recordings of inhibitory postsynaptic currents (IPSCs) provide direct functional readouts of the impact of LHFPL4 manipulation on inhibitory synaptic transmission.

  • Proximity labeling approaches: Techniques such as BioID or APEX2 fused to LHFPL4 can identify proteins in close proximity within the native cellular environment .

How does LHFPL4 compare to other tetraspanin family proteins involved in synapse function?

While tetraspanins typically act as molecular organizers that assemble protein complexes in membranes, LHFPL4's specific interaction with GABA-A receptors and selective localization to inhibitory postsynaptic sites distinguishes it from other family members. Unlike some tetraspanins involved in receptor trafficking, LHFPL4 appears to be primarily involved in receptor clustering and anchoring at synapses rather than trafficking to the surface. Research comparing LHFPL4 with other tetraspanins may reveal common mechanisms and specific adaptations that have evolved for synapse-specific functions .

What is known about the structural determinants of LHFPL4's interaction with GABA-A receptors?

The specific structural domains of LHFPL4 that mediate its interaction with GABA-A receptors remain to be fully characterized. As a tetraspanin, LHFPL4 contains four transmembrane domains with two extracellular loops and intracellular N- and C-termini. Co-immunoprecipitation studies have demonstrated that LHFPL4 can interact with multiple GABA-AR subunits (α1, α2, β3, and γ2), suggesting it may recognize conserved features across these subunits.

Further structure-function studies using deletion mutants or chimeric proteins could help identify the specific domains within LHFPL4 that are necessary and sufficient for GABA-AR binding. Similarly, mapping the regions of GABA-AR subunits that interact with LHFPL4 would provide valuable insights into this molecular interface. High-resolution structural studies, such as cryo-electron microscopy of the LHFPL4-GABA-AR complex, represent an important future direction for understanding these interactions at the atomic level .

How might LHFPL4 dysfunction contribute to neurological disorders?

Given LHFPL4's critical role in maintaining inhibitory synaptic transmission in excitatory neurons, dysfunction of this protein could potentially contribute to neurological disorders characterized by an imbalance between excitation and inhibition, such as:

  • Epilepsy: The reduction in inhibitory synaptic transmission resulting from LHFPL4 dysfunction could lead to hyperexcitability and seizures.

  • Anxiety disorders: Proper GABAergic inhibition is crucial for regulating anxiety, and disruptions in this system have been implicated in anxiety disorders.

  • Autism spectrum disorders: Many autism-related genes are involved in synapse formation and function, and alterations in excitatory/inhibitory balance are thought to contribute to the condition.

  • Intellectual disability: Given the importance of proper synaptic function for learning and memory, LHFPL4 dysfunction could impact cognitive capabilities.

While direct links between LHFPL4 mutations and human neurological disorders have not yet been established in the available sources, the cell-type specific effect of LHFPL4 on inhibitory transmission in excitatory neurons makes it an interesting candidate gene for future studies in patients with relevant neurological conditions .

What is the genomic context of the LHFPL4 gene?

FeatureInformation
Gene SymbolLHFPL4
Also known asGARLH4
Gene typeProtein coding
Chromosomal location3p25.3
Sequence positionChromosome 3; NC_000003.12 (9498361..9553822, complement)
Total number of exons5
Gene ID375323
Last updatedMarch 26, 2025

Table 1: Genomic information for the human LHFPL4 gene

What are the key experimental findings on LHFPL4 knockout phenotypes?

Experimental ParameterWild TypeLHFPL4 KnockoutSignificance
GABA-AR-γ2 clusteringNormal clustering at synapsesDramatic reduction in clustersLoss of inhibitory receptor organization
Gephyrin clusteringNormal punctate distributionDecreased clustering, formation of large intracellular aggregatesDisruption of inhibitory postsynaptic scaffold
VGAT-positive terminalsNormalUnchangedPresynaptic terminals unaffected
Homer (excitatory synapses)NormalUnchangedSpecific effect on inhibitory synapses
GABA-AR surface traffickingNormalMaintainedDefect in synaptic anchoring, not trafficking
Inhibitory postsynaptic currents in pyramidal neuronsNormalProfound reductionFunctional consequence of receptor mislocalization
Inhibitory currents in interneuronsNormalUnchangedCell-type specific effect

How does LHFPL4 localization compare at different synaptic sites?

Synaptic SiteLHFPL4 EnrichmentColocalization MarkersObservation Method
Inhibitory synapsesHigh (6-fold enrichment)Gephyrin, VGATConfocal microscopy, structured illumination microscopy (SIM)
Excitatory synapsesLowHomerConfocal microscopy
Extrasynaptic membraneMinimalN/ALive-cell imaging
Inhibitory synapses in pyramidal neuronsHighGephyrin, VGATImmunohistochemistry
Inhibitory synapses in interneuronsPresentGephyrin, VGATImmunohistochemistry

Table 3: Comparative localization of LHFPL4 at different synaptic sites based on microscopy studies

What are the key unanswered questions about LHFPL4 function?

Several important questions about LHFPL4 function remain to be addressed in future research:

  • What is the precise molecular mechanism by which LHFPL4 anchors GABA-A receptors at synapses? While we know LHFPL4 is essential for receptor clustering, the specific molecular interactions and signaling pathways involved in this process need further exploration.

  • Why does LHFPL4 demonstrate cell-type specificity, affecting pyramidal neurons but not interneurons? Understanding the molecular basis for this specificity could reveal important insights into cell-type specific synapse organization.

  • How is LHFPL4 expression and function regulated during development and in response to neuronal activity? Investigating the dynamic regulation of LHFPL4 could reveal its role in synaptic plasticity.

  • Do human LHFPL4 variants contribute to neurological or psychiatric disorders? Genetic studies in patient populations with conditions featuring altered inhibitory transmission would be valuable .

What methodological advances would enhance LHFPL4 research?

Several methodological advances could significantly enhance future LHFPL4 research:

  • High-resolution structural studies: Cryo-electron microscopy or X-ray crystallography of LHFPL4 alone and in complex with GABA-A receptor subunits would provide crucial insights into interaction mechanisms.

  • Cell-type specific manipulation in vivo: Using Cre-dependent approaches to delete or express LHFPL4 in specific neuronal populations would help dissect its cell-type specific functions.

  • Single-molecule imaging: Techniques such as single-particle tracking of LHFPL4 and GABA-A receptors would reveal dynamics of these proteins at synapses with unprecedented resolution.

  • Improved antibodies and biosensors: Development of more specific antibodies against LHFPL4 and conformational biosensors would enhance detection and functional studies.

  • Human iPSC-derived neurons: Utilizing human neurons derived from induced pluripotent stem cells would allow testing of LHFPL4 function in human cellular contexts and enable modeling of disease-associated variants .

How might therapeutic targeting of LHFPL4 be approached for neurological disorders?

While therapeutic targeting of LHFPL4 remains speculative at this stage, several approaches could be considered for future development:

  • Gene therapy approaches: For conditions associated with LHFPL4 loss-of-function, viral vector-mediated expression of LHFPL4 specifically in excitatory neurons could potentially restore inhibitory synapse function.

  • Small molecule modulators: Compounds that enhance the interaction between LHFPL4 and GABA-A receptors might strengthen inhibitory transmission in disorders characterized by reduced inhibition.

  • Peptide-based interventions: Peptides mimicking the binding interface between LHFPL4 and GABA-A receptors could potentially modulate this interaction.

  • Cell-type specific interventions: Given the cell-type specificity of LHFPL4 function, therapeutic approaches could be designed to target specific neuronal populations.

Before therapeutic development can proceed, further research is needed to fully understand LHFPL4's role in human neurological disorders and to identify specific patient populations that might benefit from such interventions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.