Recombinant Human Lipoma HMGIC fusion partner (LHFP)

Shipped with Ice Packs
In Stock

Description

General Information

The Recombinant Human Lipoma HMGIC Fusion Partner (LHFP), also known as LHFPL2 (LHFPL tetraspan subfamily member 2), is a protein associated with various biological functions and implicated in certain diseases . It belongs to the LHFPL (Lipoma HMGIC Fusion Partner-Like) gene family, a subset of the tetraspan transmembrane protein-encoding genes .

Gene and Protein Characteristics

The LHFPL2 gene encodes the LHFPL2 protein, which is part of a larger family of proteins with transmembrane domains . These proteins are involved in various cellular processes, and their encoding genes may serve as biomarkers in specific conditions .

Discovery and Initial Characterization

LHFP was initially identified as a translocation partner with the HMGIC gene in benign lipomas, which are non-cancerous tumors composed of fat cells . This discovery highlighted its involvement in mesenchymal differentiation .

Role in Bone Mass Regulation

Recent research has connected LHFP to the regulation of osteoblast function and bone mineral density (BMD) . Studies indicate that LHFP may influence bone mass by affecting cells of the osteoblast lineage . It is hypothesized that LHFP acts as a regulator of osteogenic precursor cells and their differentiation potential within the bone marrow microenvironment .

Mouse Model Studies

Genome-wide association studies (GWAS) and systems genetics have identified Lhfp as a regulator of osteoblast activity and bone mass in mice . In these studies, a significant local expression quantitative trait locus (eQTL) for Lhfp was observed in the liver . The B6 alleles of a specific SNP (rs3665395) were associated with increased expression of Lhfp and decreased BMD .

Lhfp knockout mice showed increased femoral cortical bone area fraction and cortical thickness, suggesting that Lhfp is a negative regulator of cortical bone mass .

5.1. Effects on Bone Mass

Bone ParameterObservation in Lhfp -/- Mice
Femoral Trabecular Bone MassNo significant effect
Cortical Bone Area Fraction (BA/TA)Increased
Cortical Thickness (Ct.Th)Increased
Tissue Mineral Density (TMD)Increased in male mice

Network Analysis and Functional Connections

Network analysis has revealed that Lhfp is strongly connected to genes involved in ossification, osteoblast differentiation, skeletal system development, and bone development . Key genes within the Lhfp-centric network include Sp7, Pthr1, Akp2, Tmem119, and Bmp3, all of which play roles in osteoblast differentiation and activity .

Sexual Dimorphism

The association between LHFP and bone mass regulation exhibits sexual dimorphism. The increase in cortical bone mass in Lhfp deficient mice was more pronounced in females than in males .

Other Potential Roles

GWAS have identified the human LHFP/COG6 locus as harboring variants associated with hippocampal volume . Additionally, LHFP has been implicated in the mesenchymal differentiation of gliosarcoma . LHFPL2 may serve as a potential biomarker for M2 polarization of macrophages in renal cell carcinoma .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
LHFPL6; LHFP; LHFPL tetraspan subfamily member 6 protein; Lipoma HMGIC fusion partner
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-200
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
LHFPL6
Target Protein Sequence
TSCVGFFMPYWLWGSQLGKPVSFGTFRRCSYPVHDESRQMMVMVEECGRYASFQGIPSAE WRICTIVTGLGCGLLLLVALTALMGCCVSDLISRTVGRVAGGIQFLGGLLIGAGCALYPL GWDSEEVRQTCGYTSGQFDLGKCEIGWAYYCTGAGATAAMLLCTWLACFSGKKQKHYPY
Uniprot No.

Target Background

Gene References Into Functions
  1. LHFP gene amplification is associated with mesenchymal differentiation in gliosarcoma. [PMID: 22538188](https://www.ncbi.nlm.nih.gov/pubmed/22538188)
Database Links

HGNC: 6586

OMIM: 606710

KEGG: hsa:10186

STRING: 9606.ENSP00000368908

UniGene: Hs.507798

Involvement In Disease
A chromosomal aberration involving LHFP is associated with a subclass of benign mesenchymal tumors known as lipomas. Translocation t(12;13)(q13-q15;q12) with HMGA2 is shown in lipomas.
Protein Families
LHFP family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Pancreas, kidney, skeletal muscle, liver, lung brain, heart, colon, small intestine, uterus, testis, prostate, thymus, spleen and placenta.

Q&A

What is LHFP and how was it initially discovered?

LHFP (Lipoma HMGIC Fusion Partner) was first identified as a novel human gene that functions as a translocation partner of HMGIC in lipomas with t(12;13) chromosomal translocation. The gene was initially discovered during research aimed at elucidating the functional consequences of HMGIC translocations in lipoma etiology . LHFP is a member of the lipoma HMGIC fusion partner gene family, which is a subset of the superfamily of tetraspan transmembrane protein encoding genes . The LHFP gene was mapped to the long arm of chromosome 13, a region recurrently targeted by chromosomal aberrations in lipomas .

What is the genomic organization and protein structure of LHFP?

The human LHFP gene encodes a protein of 200 amino acids . Nucleotide sequence analysis of the composite LHFP cDNA revealed an open reading frame with this length. The predicted human LHFP protein shows remarkable conservation, being almost identical to a translated mouse EST that covers nearly the entire LHFP coding region .

The protein is characterized as a tetra-transmembrane protein, with cellular localization predicted to be membrane-associated . Its molecular weight is calculated to be approximately 21.6 kDa . The protein sequence contains distinctive domains consistent with its membrane-spanning function. BLAST searches have revealed that the LHFP protein belongs to a protein family consisting of at least four or five members .

What expression systems are optimal for recombinant LHFP production?

Based on available research data, two primary expression systems have been successfully employed for recombinant LHFP production:

  • Wheat germ in vitro expression system: This system has been effectively used to express full-length human LHFP (amino acids 1-200) with an N-terminal GST tag . This approach appears particularly suitable for producing the full-length protein with proper folding.

  • HEK-293 cell expression system: For mammalian expression, HEK-293 cells have been utilized to produce recombinant LHFP with Myc-DYKDDDDK tag, yielding protein purity greater than 80% as determined by SDS-PAGE and Coomassie blue staining .

For quality control, the recombinant protein should be assessed using 12.5% SDS-PAGE stained with Coomassie Blue .

What are the optimal methods for detecting and analyzing LHFP protein?

Multiple analytical approaches have been validated for LHFP detection:

  • Western Blotting: Polyclonal antibodies against LHFP have been developed that work effectively at 1/1000 dilution for Western blot applications . These antibodies are typically raised against KLH-conjugated synthetic peptides from the N-terminal region (amino acids 21-49) of human LHFP .

  • ELISA: Anti-LHFP antibodies have also demonstrated utility in ELISA assays .

  • Other validated applications: Recombinant LHFP proteins have been successfully used in affinity purification, antibody arrays, and as controls in blocking experiments for antibody validation .

What are the recommended storage and handling conditions for recombinant LHFP?

For optimal stability and activity of recombinant LHFP:

  • Store the protein at -80°C for long-term storage .

  • Aliquot to avoid repeated freezing and thawing cycles, which can compromise protein integrity .

  • For recombinant LHFP expressed with GST tag, use buffer containing 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 .

  • The protein demonstrates best activity when used within three months from the date of receipt .

What role does LHFP play in bone mineral density regulation?

Genome-wide association studies (GWAS) and systems genetics approaches have identified LHFP as a key regulator of osteoblast activity and bone mass . Specifically:

  • A significant (P = 3.1 × 10^-12) BMD locus was identified on Chromosome 3@52.5 Mbp in mouse models, which replicated in separate inbred strain panels and overlapped a previously identified BMD quantitative trait locus (QTL) .

  • Expression analysis revealed that Lhfp is highly expressed in bone and osteoblasts, with its expression regulated by a local expression QTL (eQTL) that overlapped the BMD association .

  • A negative correlation (r = -0.29, P = 1.5 × 10^-4) was observed between Lhfp expression and bone mineral density, suggesting that increased Lhfp expression is associated with decreased BMD .

How do LHFP-deficient models affect bone formation and osteoblast activity?

LHFP-deficient mice (Lhfp^-/-) generated via CRISPR/Cas9 technology demonstrate several significant phenotypes related to bone formation:

  • Enhanced osteoblast differentiation: Bone marrow stromal cells (BMSCs) from Lhfp^-/- mice exhibit increased mineralization, as measured by bound alizarin red (P = 0.02) .

  • Increased bone mass: Lhfp^-/- mice display elevated bone mineral density due to increased cortical bone mass .

  • Sexually dimorphic effects: Although LHFP deficiency increases cortical bone mass in both sexes, the effects are slightly more pronounced in females than males .

The table below summarizes the CRISPR/Cas9-induced Lhfp mutations used in these studies:

Mutant mouse lineFounder mouseDeletion SizeBase pairs deletedChr 3 Map position deleted (GRCm38.p4 C57BL/6J)
1C4 bpTGGG53043620–530436623
2B4 & 3 bp or 8 bp + TCCTG & TGG CCTGATGG + A inserted53043615–530436618; 53043620–530436622 53043615–530436622
3A8 bpTGG GTT GC53043620–530436627
4B & C11 bpCTG ATG GGT TG53043616–530436626
5A16 bpTCA CTG CCC TGA TGG G53043608–530436623

How can network analysis be applied to predict LHFP function in bone development?

Co-expression network analysis has proven valuable for elucidating LHFP's functional role in bone development:

  • In a bone co-expression network from the Hybrid Mouse Diversity Panel (HMDP), Lhfp was identified as a member of module 9 (M9) .

  • This M9 module was specifically enriched for genes directly involved in osteoblast differentiation, genes implicated by BMD GWAS, and genes that when knocked out in mice impact BMD .

  • The network positioning suggested that Lhfp serves as a "brake" regulating the number of osteogenic precursor cells in the bone marrow microenvironment as well as their differentiation potential .

  • The strongest connections to Lhfp can be identified based on Topological Overlap Measures (TOMs), and network visualizations can be constructed using tools such as Cytoscape .

What is the role of LHFP in reproductive tract development?

Recent research has uncovered a novel function of LHFP in both female and male distal reproductive tract development:

  • Female reproductive system: A spontaneous point mutation of Lhfpl2 (LHFPL2 G102E), a member of the LHFP family, leads to 100% infertility in female mice. These mice demonstrate normal ovarian development, ovulation, uterine development, and uterine response to exogenous estrogen stimulation, but show abnormal upper longitudinal vaginal septum and lower vaginal agenesis .

  • Male reproductive system: The same mutation causes infertility in approximately 70% of male mice. These males exhibit normal mating behavior and sperm counts, but abnormal distal vas deferens convolution resulting in complete blockage of the reproductive tract in infertile males and incomplete blockage in fertile males .

  • Developmental mechanism: On embryonic day 15.5, mutant Müllerian ducts and Wolffian ducts have elongated but their duct tips are enlarged and fail to merge with the urogenital sinus, indicating a critical role for LHFP family proteins in the merging phase of reproductive tract development .

What CRISPR/Cas9 strategies have been successfully employed to study LHFP function?

CRISPR/Cas9 genome editing has been effectively utilized to generate Lhfp knockout mice, providing valuable insights into its function:

  • Guide RNA selection: The 20-nucleotide sequence for sgRNA generation was chosen using the CRISPR design tool (crispr.mit.edu), targeting a region in Exon 2 approximately 300 bp downstream of the start codon .

  • CRISPR component preparation:

    • Cas9 mRNA was synthesized and purified for embryo injection

    • The sgRNA was generated using in vitro transcription and purified using the RNeasy Plus Micro kit

  • Delivery method: C57BL/6N embryos were co-injected with purified Cas9 mRNA (100 ng/μl) and sgRNA (30 ng/μl), then implanted into pseudo-pregnant females .

  • Mutation screening: Resulting pups were screened by PCR of tail DNA with subsequent sequencing to confirm mutations .

  • Outcome analysis: This approach successfully generated mice with out-of-frame bi-allelic deletions ranging from 1-16 bp, enabling functional studies of LHFP deficiency .

What approaches are recommended for studying LHFP expression patterns?

Several complementary techniques have been validated for analyzing LHFP expression:

  • Northern blot analysis: This technique has successfully detected a 2.4 kb LHFP transcript across various human tissues .

  • Quantitative PCR (qPCR): This method has been used to assess Lhfp expression in knockout models using specific primers .

  • eQTL analysis: Expression quantitative trait loci (eQTL) analysis has been employed to identify genetic variants that regulate LHFP expression. For example, a highly significant local eQTL for Lhfp (LOD = 19.9) was identified in liver, with the lead eQTL SNP (rs3665395) located in the first intron of Lhfp .

  • Microarray expression data: Microarray-based expression profiling has been used to analyze LHFP expression across different tissues and experimental conditions. These data are accessible through public repositories such as NCBI Gene Expression Omnibus (GEO) (e.g., GSE27483, GSE11338, GSE11065, GSE12798, and GSE12795) .

What are the potential implications of LHFP in other biological processes?

Based on current research findings, several promising areas for future LHFP investigation include:

  • Broader role in skeletal disorders: Given its established function in bone mass regulation, LHFP represents a potential therapeutic target for osteoporosis and other bone density disorders. Human SNPs in LHFP have been associated (P = 1.2 × 10^-5) with heel BMD .

  • Developmental biology: The critical role of LHFP family members in reproductive tract development suggests potential involvement in other developmental processes requiring tissue fusion or morphogenesis .

  • Lipoma formation: As LHFP was initially identified in lipoma fusion events, further investigation into its role in adipose tissue biology and benign tumor formation is warranted .

  • Neural function: Human LHFP/COG6 locus has been identified by GWAS as harboring variants associated with hippocampal volume, suggesting potential neurological functions .

What methodological advances might enhance LHFP research?

Emerging technologies with particular promise for advancing LHFP research include:

  • Single-cell transcriptomics: To define cell-type specific expression patterns of LHFP in complex tissues like bone marrow and reproductive organs.

  • Proximity labeling approaches: Techniques such as BioID or APEX2 could help identify the proximal interactome of membrane-associated LHFP.

  • Cryo-electron microscopy: This approach could provide structural insights into the tetraspan transmembrane configuration of LHFP and its potential interactions with other membrane proteins.

  • Tissue-specific inducible knockouts: Conditional and temporally controlled LHFP deletion models would allow more precise dissection of its function in specific developmental windows or adult tissues.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.