Recombinant Human Long-chain fatty acid transport protein 3 (SLC27A3)

Shipped with Ice Packs
In Stock

Description

General Information

The SLC27A3 gene encodes an integral membrane protein involved in lipid metabolism . This protein, Long-chain fatty acid transport protein 3 (SLC27A3), primarily functions as an acyl-CoA ligase, catalyzing the ATP-dependent formation of fatty acyl-CoA from long-chain fatty acids (LCFA) and very-long-chain fatty acids (VLCFA) . SLC27A3 was initially identified as very long-chain acyl-CoA synthetases (ACSVL3) and was shown to mediate the activation of C16:0 and C24:0 fatty acids in mice .

Gene Details

SLC27A3, or solute carrier family 27 member 3, is a gene that belongs to a family of integral membrane proteins . The protein encoded by this gene is involved in lipid metabolism . Resequencing of the SLC27A3 gene has revealed multiple variants in individuals with autism spectrum disorders (ASD) .

Expression and Function

SLC27A3 is highly expressed in lipid-rich tumors such as clear cell renal cell carcinoma (ccRCC) and glioblastoma . It is involved in various metabolic processes, including $$ \beta $$-oxidation, lipid synthesis, fatty acid modification, and posttranslational modification . As an acyl-CoA ligase, SLC27A3 catalyzes the conversion of LCFAs and VLCFAs into fatty acyl-CoA, which is crucial for these metabolic activities .

Role in Cancer

SLC27A3 mediates resistance to tyrosine kinase inhibitors (TKIs) in ccRCC by regulating lipid droplet (LD) synthesis . Knockdown of SLC27A3 suppresses LD accumulation and mitophagy, overcoming pazopanib resistance in vitro and in vivo . SLC27A3 affects LD formation and TKI resistance in ccRCC by regulating reactive oxygen species (ROS) levels and mitophagy .

Mitophagy Regulation

SLC27A3 mediates mitophagy by regulating ROS levels, affecting LD formation and TKI resistance in ccRCC . SLC27A3 knockdown decreases PINK1 and Parkin expression levels, reducing mitophagy activity . Overexpression of SLC27A3 augments colony formation ability and cell viability, while subsequent downregulation of PINK1 can reverse this effect .

Regulation by STAT2

The transcription factor STAT2 influences the expression of SLC27A3 . STAT2 binds to the promoter of SLC27A3 mRNA to promote its transcription, regulating LD metabolism and activating mitophagy during pazopanib resistance . Upregulation of STAT2 is linked to worse survival outcomes in ccRCC patients .

Clinical Significance

SLC27A3 is a potential diagnostic marker for ccRCC, with high expression correlating with poorer prognosis . It is also a potential therapeutic target for managing ccRCC TKI resistance . SLC27A3 is mainly highly expressed in lipid-enriched tumors such as ccRCC and glioblastoma, suggesting that SLC27A3 is certain lipid tumor specific, which is the main feature that distinguishes it from other oncogenes in ccRCC . The tumor specificity of SLC27A3 in ccRCC is an important prerequisite for the development of targeted drugs .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SLC27A3; ACSVL3; FATP3; PSEC0067; UNQ367/PRO703; Solute carrier family 27 member 3; Arachidonate--CoA ligase; Long-chain fatty acid transport protein 3; FATP-3; Fatty acid transport protein 3; Very long-chain acyl-CoA synthetase homolog 3; VLCS-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-730
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SLC27A3
Target Protein Sequence
MGVCQRTRAPWKEKSQLERAALGFRKGGSGMFASGWNQTVPIEEAGSMAALLLLPLLLLL PLLLLKLHLWPQLRWLPADLAFAVRALCCKRALRARALAAAAADPEGPEGGCSLAWRLAE LAQQRAAHTFLIHGSRRFSYSEAERESNRAARAFLRALGWDWGPDGGDSGEGSAGEGERA APGAGDAAAGSGAEFAGGDGAARGGGAAAPLSPGATVALLLPAGPEFLWLWFGLAKAGLR TAFVPTALRRGPLLHCLRSCGARALVLAPEFLESLEPDLPALRAMGLHLWAAGPGTHPAG ISDLLAEVSAEVDGPVPGYLSSPQSITDTCLYIFTSGTTGLPKAARISHLKILQCQGFYQ LCGVHQEDVIYLALPLYHMSGSLLGIVGCMGIGATVVLKSKFSAGQFWEDCQQHRVTVFQ YIGELCRYLVNQPPSKAERGHKVRLAVGSGLRPDTWERFVRRFGPLQVLETYGLTEGNVA TINYTGQRGAVGRASWLYKHIFPFSLIRYDVTTGEPIRDPQGHCMATSPGEPGLLVAPVS QQSPFLGYAGGPELAQGKLLKDVFRPGDVFFNTGDLLVCDDQGFLRFHDRTGDTFRWKGE NVATTEVAEVFEALDFLQEVNVYGVTVPGHEGRAGMAALVLRPPHALDLMQLYTHVSENL PPYARPRFLRLQESLATTETFKQQKVRMANEGFDPSTLSDPLYVLDQAVGAYLPLTTARY SALLAGNLRI
Uniprot No.

Target Background

Function
This protein exhibits acyl-CoA ligase activity for long-chain and very-long-chain fatty acids. It does not possess fatty acid transport activity.
Gene References Into Functions
  1. Studies indicate that ACSVL3, a lipid metabolism enzyme, is involved in the maintenance of glioblastoma (GBM) stem cells and their tumor-initiating capacity in animal models. (PMID: 24893952)
  2. Elevated ACSVL3 levels were consistently observed across various lung tumor types, including adeno-, squamous cell, large cell, and small cell carcinomas. (PMID: 23936004)
  3. ACSVL3 sustains the oncogenic properties of malignant glioma cells, partly through Akt function regulation. (PMID: 19920185)
Database Links

HGNC: 10997

OMIM: 604193

KEGG: hsa:11000

STRING: 9606.ENSP00000357650

UniGene: Hs.438723

Protein Families
ATP-dependent AMP-binding enzyme family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in bronchial and bronchiolar epithelial cells (at protein level).

Q&A

What is SLC27A3 and what is its role in fatty acid metabolism?

SLC27A3, also known as FATP3 (Fatty Acid Transport Protein 3) or ACSVL3 (Very Long-Chain Acyl-CoA Synthetase 3), is a member of the SLC27 gene family that encodes integral membrane proteins involved in the cellular uptake and activation of long-chain fatty acids (LCFA) and very long-chain fatty acids (VLCFA) . Like other FATP family members, SLC27A3 likely functions as a bifunctional protein with both transport capabilities and enzymatic activity (acyl-CoA synthetase).

SLC27A3 contains the highly conserved 311-amino acid FATP sequence found in all members of this family, as well as an AMP binding domain located at the C-terminus, which is responsible for binding and uptake of LCFA . The protein is predicted to have at least one transmembrane domain with the N-terminus located on the extracellular/luminal side and the C-terminus on the cytosolic side .

How does SLC27A3 expression vary across different tissues?

SLC27A3 shows a tissue-specific expression pattern that differs from other FATP family members. Based on current research, SLC27A3 is predominantly expressed in:

  • Skin

  • Adrenal gland

  • Testis

  • Ovary

  • Brain

  • Lung

  • Endothelial cells

This tissue distribution suggests specialized functions for SLC27A3 in these organs. Understanding the differential expression patterns can help researchers target the most relevant tissues when designing experiments to study SLC27A3 function.

What structural features distinguish SLC27A3 from other FATP family members?

Like all members of the FATP family, SLC27A3 shares several key structural features:

  • A size range of 63-80 kilodaltons

  • Integral membrane protein with at least one transmembrane domain

  • N-terminus located on the extracellular/luminal side

  • C-terminus on the cytosolic side

  • A highly conserved 311-amino acid FATP signature sequence

  • An AMP binding domain on the C-terminus responsible for binding and uptake of LCFA

While specific structural information about SLC27A3 is limited compared to other FATP family members, it likely contains similar functional domains. Unlike FATP4, which has a distinct ER localization signal domain, specific unique structural elements of SLC27A3 have not been well characterized in the current literature .

What methods are commonly used to detect and measure SLC27A3 expression?

Several methodological approaches can be used to detect and quantify SLC27A3 expression:

  • mRNA detection:

    • Quantitative RT-PCR using specific primers for SLC27A3

    • In situ hybridization for tissue localization

    • RNA sequencing for transcriptome-wide analysis

  • Protein detection:

    • Western blotting using specific antibodies against SLC27A3

    • Immunohistochemistry for tissue localization

    • Immunofluorescence for subcellular localization

    • Flow cytometry for cell-specific expression analysis

  • Functional assays:

    • Fatty acid uptake assays using labeled fatty acids

    • Acyl-CoA synthetase activity assays to measure enzymatic function

When designing primers or selecting antibodies, researchers should consider potential cross-reactivity with other FATP family members due to sequence similarities.

How does SLC27A3 compare with other members of the FATP family?

The table below summarizes key characteristics of SLC27A3 compared to other members of the FATP family:

FeatureSLC27A1/FATP1SLC27A2/FATP2SLC27A3/FATP3SLC27A4/FATP4SLC27A5/FATP5SLC27A6/FATP6
Predominant substratesLCFA, VLCFALCFA, VLCFALCFA, VLCFALCFA, VLCFALCFA, bile acidsLCFA, VLCFA
Transport/enzymatic functionLCFA transport, VLCFA activationLCFA transport, VLCFA activationLCFA transport, VLCFA activationLCFA transport, VLCFA activationLCFA transport, bile acid conjugationLCFA transport, VLCFA activation
Primary tissue expressionBAT, WAT, heart, skeletal muscle, skin, brain, kidneyLiver, kidney cortex, placentaSkin, adrenal gland, testis, ovary, brain, lung, endothelial cellsSmall intestine, skin, placenta, brain, skeletal muscle, WATLiverHeart, skin
Human gene locus19p13.1115q21.21q21.39q34.1119q13.435q23.3
Associated diseasesUnknownUnknownUnknownRestrictive dermopathyUnknownUnknown
RefSeq accessionNM_198580.1NM_003645.3 (V1), NM_001159629.1 (V2)NM_024330.1NM_005094.3NM_012254.2NM_014031.3 (V1), NM_001017372.1 (V2)

This comparison highlights both the similarities in substrate preference and differences in tissue distribution among the FATP family members .

What are the challenges in expressing and purifying recombinant SLC27A3 protein?

Researchers working with recombinant SLC27A3 face several technical challenges:

  • Membrane protein expression:

    • As an integral membrane protein, SLC27A3 contains hydrophobic domains that make heterologous expression difficult

    • Expression systems must maintain proper protein folding and membrane insertion

    • Recommended approach: Use specialized expression systems such as insect cells (Sf9, High Five) or mammalian cells rather than bacterial systems for proper post-translational modifications

  • Solubilization and purification:

    • Requires careful selection of detergents that maintain protein structure and function

    • Common detergents include n-dodecyl-β-D-maltoside (DDM), digitonin, or CHAPS

    • Purification typically employs affinity tags (His, FLAG, GST) followed by size exclusion chromatography

    • Consider using lipid nanodiscs or proteoliposomes to maintain a lipid environment during functional studies

  • Functional verification:

    • Activity assays should test both transport function and enzymatic (acyl-CoA synthetase) activity

    • Transport can be measured using fluorescently labeled fatty acids

    • Enzymatic activity can be assessed through acyl-CoA synthetase assays measuring ATP consumption or CoA incorporation

  • Stability issues:

    • Consider adding lipids during purification to enhance stability

    • Optimize buffer conditions (pH, salt concentration, glycerol content)

    • Use thermal shift assays to identify stabilizing conditions

How can researchers distinguish between the transport and enzymatic functions of SLC27A3?

Differentiating between the dual functions of SLC27A3 requires specialized experimental approaches:

  • Site-directed mutagenesis:

    • Mutate the AMP binding domain to disrupt enzymatic activity while potentially preserving transport function

    • Compare wild-type and mutant proteins in functional assays to separate the two activities

    • The AMP binding domain in the FATP family is responsible for the acyl-CoA synthetase activity

  • Transport assays independent of metabolism:

    • Use non-metabolizable fatty acid analogs that can be transported but not activated

    • Employ fluorescent fatty acid analogs with real-time imaging to measure initial uptake rates before metabolism occurs

    • Perform assays at low temperatures to slow enzymatic reactions while still allowing transport

  • Enzymatic activity assays:

    • Measure acyl-CoA synthetase activity in membrane preparations or with purified protein

    • Quantify ATP consumption or CoA incorporation into fatty acids

    • Compare activity with various fatty acid chain lengths to determine substrate specificity

  • Competitive inhibition studies:

    • Use specific inhibitors of either transport or enzymatic function

    • Triacsin C inhibits acyl-CoA synthetase activity of some FATP family members

    • Compare effects on fatty acid uptake versus activation

What experimental models are most appropriate for studying SLC27A3 function?

Several experimental models can be employed to study SLC27A3 function, each with specific advantages:

  • Cell culture models:

    • Overexpression systems: Transiently or stably express SLC27A3 in cell lines with low endogenous expression

    • Knockdown/knockout approaches: siRNA, shRNA, or CRISPR-Cas9 to reduce or eliminate SLC27A3 expression

    • Recommended cell lines: Those derived from tissues with high endogenous expression (skin cells, lung cells, neuronal cells)

  • Genetically modified animals:

    • Knockout models to study systemic effects of SLC27A3 deficiency

    • Tissue-specific conditional knockouts to avoid potential embryonic lethality and study tissue-specific functions

    • Knockin reporter models to track expression patterns

  • Ex vivo systems:

    • Tissue explants from relevant organs (skin, brain, adrenal gland)

    • Primary cell cultures that maintain tissue-specific functions

  • Alternative models:

    • Zebrafish: For developmental studies and high-throughput screening

    • Drosophila: For genetic interaction studies

    • Xenopus oocytes: For transport studies using electrophysiology

When selecting a model, researchers should consider the endogenous expression level of SLC27A3 and the specific aspect of function being studied.

How might SLC27A3 contribute to pathological conditions?

While direct links between SLC27A3 and specific diseases have not been firmly established, several potential pathological connections can be explored based on its function and expression pattern:

  • Neurological disorders:

    • Given its expression in the brain, SLC27A3 might contribute to neurological conditions associated with lipid metabolism

    • Research direction: Investigate SLC27A3 expression in neurodegenerative disease models

    • Methodology: Compare expression levels in affected vs. unaffected brain regions using qPCR and immunohistochemistry

  • Skin disorders:

    • SLC27A3's expression in skin suggests potential roles in dermatological conditions

    • Unlike SLC27A4/FATP4, which is linked to restrictive dermopathy , specific skin conditions associated with SLC27A3 remain to be identified

    • Research direction: Examine SLC27A3 expression in various skin disorders, especially those involving lipid metabolism

  • Metabolic diseases:

    • Aberrant fatty acid metabolism contributes to metabolic disorders

    • Research direction: Investigate potential roles in lipotoxicity and insulin resistance

    • Methodology: Measure changes in SLC27A3 expression in diet-induced obesity models

  • Reproductive system disorders:

    • Expression in testis and ovary suggests potential reproductive functions

    • Research direction: Examine roles in gametogenesis and fertility

  • Cancer:

    • Altered metabolism is a hallmark of cancer cells

    • Research direction: Investigate SLC27A3 expression in cancer tissues, particularly from organs where it is normally expressed

    • Methodology: Analysis of cancer genomics databases for alterations in SLC27A3 expression or mutations

What are the current technical limitations in SLC27A3 research and how can they be addressed?

Several technical challenges currently limit our understanding of SLC27A3:

  • Specificity of detection tools:

    • Challenge: Cross-reactivity of antibodies with other FATP family members

    • Solution: Validate antibodies against recombinant proteins and in knockout systems

    • Alternative approach: Use epitope-tagged constructs when studying overexpression systems

  • Functional assays:

    • Challenge: Difficulty in distinguishing transport from activation functions

    • Solution: Develop assays that specifically measure one function independent of the other

    • Approach: Use non-metabolizable fatty acid analogs for transport studies

  • Physiological relevance:

    • Challenge: Understanding the biological significance of SLC27A3 in specific tissues

    • Solution: Develop tissue-specific knockout models

    • Approach: Use conditional knockout strategies targeting tissues with high expression

  • Structural information:

    • Challenge: Limited structural data on SLC27A3

    • Solution: Apply cryo-electron microscopy or X-ray crystallography to the purified protein

    • Alternative approach: Use computational modeling based on more well-characterized FATP family members

  • Redundancy within the FATP family:

    • Challenge: Functional overlap with other FATP family members may mask phenotypes

    • Solution: Generate double or triple knockout models

    • Approach: First characterize the expression patterns of all FATP family members in tissues of interest

How can researchers optimize fatty acid uptake assays to study SLC27A3 function?

Fatty acid uptake assays are crucial for studying SLC27A3 function. The following methodological considerations can improve their reliability:

  • Selection of fatty acid analogs:

    • Use fluorescently labeled fatty acids like BODIPY-labeled fatty acids or radiolabeled fatty acids (³H or ¹⁴C)

    • Match the chain length to the known substrate preferences of SLC27A3 (long-chain or very long-chain fatty acids)

    • Consider both saturated and unsaturated fatty acids to determine substrate specificity

  • Assay optimization:

    • Temperature: Perform assays at physiological temperature (37°C) for optimal activity

    • Time course: Include early time points (seconds to minutes) to capture initial uptake rates

    • Concentration range: Use multiple fatty acid concentrations to determine kinetic parameters

  • Controls and normalization:

    • Include competitive inhibitors of fatty acid uptake

    • Use cells with knocked down or knocked out SLC27A3 as negative controls

    • Normalize uptake to cell number, protein content, or membrane surface area

  • Distinguishing uptake from metabolism:

    • Perform assays at low temperatures to slow metabolism

    • Use metabolic inhibitors to block downstream metabolism

    • Compare results with non-metabolizable fatty acid analogs

  • Data analysis:

    • Calculate initial rates rather than endpoint measurements

    • Determine kinetic parameters (Km, Vmax) for different fatty acid substrates

    • When comparing multiple cell lines or conditions, ensure equivalent expression levels of SLC27A3

What are the most significant recent advances in SLC27A3 research?

While the search results don't provide specific recent advances for SLC27A3, several developments in the broader FATP field have implications for SLC27A3 research:

  • Improved understanding of the dual functionality of FATP proteins:

    • Recent studies have elucidated how the transport and enzymatic functions of FATPs may be interconnected

    • The "vectorial acylation" model suggests that transport and activation are coupled processes

    • This model can guide studies on the specific mechanisms of SLC27A3

  • Advances in membrane protein structural biology:

    • Cryo-electron microscopy advances could facilitate structural studies of SLC27A3

    • Structural information would provide insights into substrate binding sites and functional domains

  • Tissue-specific roles of FATP proteins:

    • Studies of other FATP family members have revealed tissue-specific functions

    • For example, FATP1 has been shown to influence thermogenesis in brown adipose tissue

    • Similar tissue-specific functions may exist for SLC27A3 in its primary expression sites

What methodological advances could accelerate SLC27A3 research?

Several emerging technologies and methodological approaches could advance SLC27A3 research:

  • CRISPR-Cas9 genome editing:

    • Generate precise modifications in the SLC27A3 gene

    • Create reporter lines with endogenous tagging of SLC27A3

    • Develop cellular and animal models with specific mutations in functional domains

  • Single-cell technologies:

    • Apply single-cell RNA sequencing to identify cell populations with high SLC27A3 expression

    • Use single-cell metabolomics to analyze fatty acid metabolism in specific cell types

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize subcellular localization

    • Live-cell imaging with fluorescent fatty acids to track transport in real-time

    • Proximity labeling techniques (BioID, APEX) to identify protein interaction partners

  • Metabolomics approaches:

    • Lipidomics analysis to characterize changes in lipid profiles upon SLC27A3 modulation

    • Stable isotope tracing to track fatty acid fate after uptake

  • High-throughput screening:

    • Develop assays compatible with high-throughput screening to identify selective inhibitors or activators

    • Use compound libraries to find small molecules that modulate SLC27A3 function

How might systems biology approaches enhance our understanding of SLC27A3 function?

Systems biology approaches can provide comprehensive insights into SLC27A3's role within broader metabolic networks:

  • Network analysis:

    • Integrate transcriptomics, proteomics, and metabolomics data

    • Identify regulatory networks controlling SLC27A3 expression

    • Map interactions between SLC27A3 and other components of fatty acid metabolism

  • Mathematical modeling:

    • Develop kinetic models of fatty acid uptake and metabolism

    • Simulate the effects of SLC27A3 modulation on cellular lipid homeostasis

    • Predict compensatory mechanisms in response to SLC27A3 perturbation

  • Multi-omics integration:

    • Combine genomics, transcriptomics, proteomics, and metabolomics data

    • Identify potential biomarkers associated with altered SLC27A3 function

    • Discover novel regulatory mechanisms

  • Comparative analysis across species:

    • Evolutionary analysis of FATP family members

    • Cross-species comparison of expression patterns and functions

    • Identify conserved and divergent aspects of SLC27A3 biology

How should researchers design experiments to study SLC27A3 in cell culture systems?

Effective experimental design for studying SLC27A3 in cell culture requires careful consideration of several factors:

  • Cell line selection:

    • Choose cell lines that naturally express SLC27A3 (derived from skin, brain, or adrenal gland)

    • Alternatively, use cell lines with minimal endogenous expression for gain-of-function studies

    • Consider immortalized cell lines versus primary cells based on research questions

  • Expression modulation strategies:

    • Overexpression: Use expression vectors with appropriate promoters (constitutive or inducible)

    • Knockdown: siRNA or shRNA approaches targeting specific regions of SLC27A3

    • Knockout: CRISPR-Cas9 for complete gene deletion

    • Tag selection: Consider epitope tags (FLAG, HA, His) that won't interfere with protein function

  • Controls:

    • Empty vector controls for overexpression studies

    • Non-targeting siRNA/shRNA for knockdown studies

    • Wild-type cells for knockout studies

    • Include other FATP family members as comparative controls

  • Validation of expression modulation:

    • Verify changes at both mRNA (qRT-PCR) and protein (Western blot) levels

    • Confirm subcellular localization using immunofluorescence

    • Validate functional consequences using fatty acid uptake assays

  • Experimental conditions:

    • Consider the effects of cell confluence on membrane protein expression

    • Account for the influence of culture medium composition on lipid metabolism

    • Include time course analyses to capture dynamic processes

What considerations are important when analyzing SLC27A3 expression in tissue samples?

Analysis of SLC27A3 expression in tissue samples requires attention to several methodological details:

  • Sample collection and preservation:

    • Fresh tissue is optimal for RNA and protein extraction

    • Flash freezing for metabolomic analyses

    • Appropriate fixatives for histological analyses (consider that some fixatives affect lipid preservation)

  • Expression analysis techniques:

    • qRT-PCR: Design primers specific to SLC27A3 that don't amplify other FATP family members

    • Western blotting: Use validated antibodies and appropriate loading controls

    • Immunohistochemistry: Include positive and negative control tissues

    • RNA-Seq: Consider depth of sequencing needed to detect lower abundance transcripts

  • Cellular heterogeneity:

    • Recognize that whole tissue analyses may mask cell-type specific expression patterns

    • Consider laser capture microdissection for cell-type specific analyses

    • Single-cell approaches for heterogeneous tissues

  • Comparative analysis:

    • Include multiple tissue types to confirm tissue-specific expression patterns

    • Compare expression across developmental stages

    • Include tissues from multiple individuals to account for biological variation

  • Contextual factors:

    • Consider nutritional status effects on expression

    • Account for circadian variations

    • Note any disease states or medications that might affect lipid metabolism

How can researchers interpret conflicting data on SLC27A3 function?

When faced with conflicting data about SLC27A3 function, researchers should:

  • Examine methodological differences:

    • Compare experimental systems used (cell lines, animal models, in vitro assays)

    • Assess differences in protein expression levels across studies

    • Evaluate the specificity of detection methods

    • Consider differences in fatty acid substrates used in functional assays

  • Consider contextual factors:

    • Cell type-specific effects may explain different functional outcomes

    • Compensatory mechanisms might be activated in different experimental systems

    • Interaction with other proteins may vary across experimental conditions

  • Validation approaches:

    • Replicate key experiments using multiple methodologies

    • Use complementary techniques to verify findings

    • Perform dose-response studies to identify threshold effects

    • Assess the effects of different fatty acid substrates

  • Reconciliation strategies:

    • Develop working models that accommodate seemingly conflicting data

    • Consider biphasic responses or context-dependent functions

    • Propose testable hypotheses to resolve contradictions

  • Collaborative approaches:

    • Engage with other labs to perform cross-validation studies

    • Share reagents to eliminate technical variables

    • Consider multi-lab consortium approaches for complex questions

What are the most promising research directions for SLC27A3 studies?

For researchers entering the SLC27A3 field, the following directions offer significant potential:

  • Tissue-specific functions:

    • Investigate the specific roles of SLC27A3 in tissues where it shows high expression

    • Focus on skin, brain, and adrenal gland, where its function may be most physiologically relevant

    • Explore potential roles in testis and ovary, which have been less studied

  • Substrate specificity:

    • Characterize the fatty acid substrate preferences of SLC27A3

    • Compare transport and activation capabilities for different fatty acid species

    • Investigate potential roles in specialized lipid metabolism pathways

  • Regulation of expression and activity:

    • Identify transcriptional regulators of SLC27A3 expression

    • Explore post-translational modifications that affect function

    • Investigate potential regulation by metabolic stimuli

  • Protein-protein interactions:

    • Identify binding partners that may modulate SLC27A3 function

    • Explore potential interactions with other components of fatty acid metabolism

    • Investigate formation of homo- or heterodimers with other FATP family members

  • Disease associations:

    • Examine SLC27A3 expression in disorders affecting tissues where it is normally expressed

    • Investigate potential roles in skin disorders, neurological conditions, or metabolic diseases

    • Explore genetic variations in SLC27A3 and their potential clinical implications

What key methodological recommendations should new researchers in the field follow?

Researchers new to SLC27A3 studies should consider these methodological recommendations:

  • Validation of tools and reagents:

    • Thoroughly validate antibodies for specificity against other FATP family members

    • Verify siRNA/shRNA specificity through rescue experiments

    • Include appropriate positive and negative controls in all experiments

  • Comprehensive functional assessment:

    • Evaluate both transport and enzymatic functions

    • Use multiple complementary assays for each function

    • Include time course and dose-response studies

  • Physiological relevance:

    • Use physiologically relevant fatty acid concentrations

    • Consider the lipid composition of cell culture media

    • Relate in vitro findings to in vivo physiology when possible

  • Collaborative approaches:

    • Engage with researchers studying other FATP family members

    • Collaborate with experts in lipid metabolism and membrane protein biology

    • Consider multi-disciplinary approaches combining molecular, cellular, and physiological studies

  • Open science practices:

    • Share detailed protocols to improve reproducibility

    • Make reagents available to the research community

    • Report negative results to advance the field's understanding

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.