Recombinant Human Low affinity immunoglobulin epsilon Fc receptor (FCER2)

Shipped with Ice Packs
In Stock

Description

Production and Characterization

Commercial recombinant FCER2 is produced through multiple expression systems:

Expression Platforms Compared

VendorHost SystemTagRegion ExpressedPurity
BiomatikE. coliN-terminal Hisaa 48–248>90%
AbbexaMammalian cellsC-terminal Hisaa 48–321>90%
BioLegendHEK293 cellsCarrier-freeFull extracellular>95%

E. coli-expressed versions (27.3 kDa) lack glycosylation but retain ligand-binding capacity, while mammalian-expressed forms (33.9–49.9 kDa) better mimic native post-translational modifications .

Mechanistic Studies

  • IgE Regulation: Soluble FCER2 induces IgE production at low concentrations (EC₅₀ = 2–5 nM) but inhibits it at higher levels through feedback mechanisms .

  • Immune Cell Signaling: Binds CD21 on B-cells, initiating antigen presentation cascades (p < 0.01 vs controls) .

Disease Models

Disease AreaExperimental UseKey Finding
Allergic AsthmaIgE binding kinetics analysisKd = 1.2×10⁶ M⁻¹
Autoimmune DisordersBlocking FCER2-CD21 interactionReduced autoantibody production by 68%
Parasitic InfectionsMacrophage activation studiesEnhanced NO production (2.4-fold)

Emerging Therapeutic Applications

Recent studies utilizing recombinant FCER2:

  1. Antibody Development: Lumiliximab (anti-CD23) showed 40% reduction in malignant B-cell counts during Phase I trials .

  2. Cytokine Modulation: FCER2-CD11b interaction increases IL-6 secretion by 3.7-fold in monocytes (p < 0.001) .

  3. Diagnostic Tools: Used as capture antigen in IgE affinity assays (r² = 0.93 vs native protein) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order, and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Blast 2; BLAST-2; Blast2; C type lectin domain family 4 member J; C-type lectin domain family 4; C-type lectin domain family 4 member J; C-type lectin domain family 4; member J; CD 23; CD 23A; CD23; CD23 antigen; CD23A; CLEC 4J; CLEC4J; Fc epsilon receptor II; Fc epsilon RII; Fc fragment of IgE; Fc fragment of IgE low affinity II receptor for; Fc fragment of IgE receptor II; Fc fragment of IgE; low affinity II; receptor for (CD23); Fc of IgE; Fc of IgE; low affinity II; receptor for (CD23); Fc receptor IgE low affinity II alpha polypeptide; Fc receptor; IgE; low affinity II; alpha polypeptide; isoform CRA_a; Fc-epsilon-RII; FCE 2; FCE2; FCER 2; Fcer2; FCER2_HUMAN; FCER2A; FceRII; IgE binding factor; IgE receptor lymphocyte; IgE-binding factor; IGEBF; Immunoglobulin E binding factor; Immunoglobulin E receptor; Immunoglobulin E receptor; low affinity II; Immunoglobulin E-binding factor; Immunoglobulin epsilon chain; LEUKOCYTE ANTIGEN CD23; Low Affinity IgE Receptor; Low affinity immunoglobulin epsilon Fc receptor; Low affinity immunoglobulin epsilon Fc receptor membrane bound form; Low affinity immunoglobulin epsilon Fc receptor soluble form; Ly-42; Ly42; Lymphocyte antigen CD23; Lymphocyte IgE receptor; MGC93219
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-321
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
Uniprot No.

Target Background

Function
CD23 is a low-affinity receptor for immunoglobulin E (IgE) and CR2/CD21. It plays crucial roles in regulating IgE production and in the differentiation of B-cells (acting as a B-cell-specific antigen).
Gene References Into Functions
  1. Reports a variant of t(14;18) negative nodal diffuse follicular lymphoma with CD23 expression, 1p36/TNFRSF14 abnormalities, and STAT6 mutations. PMID: 26965583
  2. High CD23 expression is associated with B-cell Lymphoma. PMID: 28108506
  3. Observed a higher frequency of LIN1(-) CCR3(+) eosinophils, and decreased expression of CD23 and CD62L receptors in eosinophils of AD patients. PMID: 27406841
  4. A high CD23a/CD23b ratio of chronic lymphocytic leukemia cells indicates that in a subset of CLL cases, low CD23 expression coupled with high CD20 and CD38 expressions may serve as a surrogate for trisomy 12. PMID: 26119874
  5. Binding of CTLA4Fcepsilon to FcepsilonRII/CD23 appeared stronger than that of IgE. PMID: 26801967
  6. Human and murine P2X7 activation induces the rapid shedding of CD23 from B cells, with a potential role for ADAM10 in this process. PMID: 25155463
  7. Elevated serum sCD23 is associated with an increased risk of non-Hodgkin lymphoma. PMID: 25567136
  8. Data suggests that the protective immune response involves CD23-IgE-mediated nitric oxide release in cutaneous leishmaniasis (LCL). PMID: 25802003
  9. Crystal structure of the CD23-Fc3-4 complex with different molecular-packing constraints. PMID: 24598915
  10. Data indicate that the studied FCER2 variations are strongly associated with asthma susceptibility and might be a risk factor among north Indian asthmatic children. PMID: 24102092
  11. We have demonstrated that PU.1, GATA1, and GATA2 are involved in the expression of FcepsilonRI in a human mast cell line and primary human mast cells using siRNA with high transfection efficiency, and by ChIP assay. PMID: 24639354
  12. CD23b-R62W-expressing human B cells bind IgE with greater affinity than wild-type cells and display differences in kinetics of CD23-mediated ERK1/2 activation. PMID: 24010859
  13. The interplay of free IgE with IgE-allergen immune complexes of different sizes and composition with CD23 binding represents a mechanism for the modulation of CD23-mediated immune responses. PMID: 23229638
  14. Data indicate that the interaction of IgE with CD23 on B-cells regulates IgE production. PMID: 23933509
  15. Results suggest that binding of Ca(2+) brings an extra degree of modulation to CD23 function. PMID: 23775083
  16. The results are consistent with the suppression of parasite and allergen-specific IgE levels by sCD23. PMID: 23689700
  17. Data indicate that upon sialylation, the affinities for Fcgamma receptors are reduced, whereas those for alternative cellular receptors, such as dendritic cell-specific intercellular adhesion molecule-3-grabbing nonintegrin (DC-SIGN)/CD23, are increased. PMID: 23697368
  18. Results support the complex model of CD23 induction by Epstein-Barr virus (EBV). PMID: 23583387
  19. Downregulation of CD23 attenuated AIMP1-induced TNF-alpha secretion and AIMP1 binding. PMID: 22767513
  20. All subtypes of juvenile arthritis have reduced circulating levels of sCD21 and sCD23. PMID: 21328056
  21. CD23 and FcepsilonRI interaction sites are at opposite ends of the Cepsilon3 domain of IgE, but that receptor binding is mutually inhibitory, mediated by an allosteric mechanism. PMID: 22815482
  22. Structural comparisons with both free IgE-Fc and its FcepsilonRI complex reveal not only that the conformational changes in IgE-Fc required for CD23 binding are incompatible with FcepsilonRI binding, but also that the converse is true. PMID: 22802656
  23. Binding of sCD23-derived peptides to av integrins and their biological activities are tolerant of some substitution in the recognition motif. PMID: 22560905
  24. Findings suggest that patients with t(11;14)(+)/CD23(+) plasma cell myelomas (PCM) present with lower platelet counts and may have a shorter overall survival than those with t(11;14)(+)/CD23(-) PCM. PMID: 21724429
  25. Variation at GLCCI1 and FCER2 could lead to personalized asthma treatment. PMID: 22304573
  26. Soluble CD23 promoted the release of cytokines from the THP-1 model cell line. In both model cell lines and primary tissue, cytokine release was more pronounced in immature monocyte cells than in mature cells. PMID: 22348662
  27. mIgE & mCD21 cooperate in sCD23-mediated positive regulation of IgE synthesis on committed B cells. Feedback regulation may occur when the secreted-IgE level is sufficient to allow binding to mCD23. This prevents further sCD23 release. PMID: 22393152
  28. Transfectants expressing the single nucleotide polymorphism in FCER2 exhibited increased IL-4Ralpha expression after stimulation through CD23 compared with wild-type. PMID: 22059556
  29. Our results suggest that the FCER2 T2206C variant might be a useful pharmacogenetic predictor of steroid refractory patients. PMID: 21958076
  30. SPR analysis revealed a progressive increment in affinity of soluble fragments for IgE, upon increasing length of CD23 "stalk" domain, exCD23>sCD23>derCD23. PMID: 21889131
  31. The association of CD23 and CD30 antigen blood levels with the development of non-Hodgkin lymphoma in HIV patients is reported. PMID: 21860351
  32. Report the role of CD23 SNPs in IgE dependent signaling in B-lymphocytes. PMID: 21686206
  33. IgE may be considered as an immune mediator during antiprotozoal activity of human macrophages through its ability to trigger CD23 signaling. PMID: 21526166
  34. Show for the first time that CD9 and CD81 act as molecular partners of trimeric FcvarepsilonRI on human antigen-presenting cell. PMID: 21241315
  35. CD23 and CD19 are important factors associated with serum total IgE in the pathogenesis of allergic rhinitis. PMID: 20359104
  36. CD23-mediated immunoglobulin (Ig)E transcytosis in human airway epithelial cells may play a critical role in initiating and contributing to the perpetuation of airway allergic inflammation. PMID: 21307287
  37. A model of CD23-bound IgE-mediated amplification of immunity by B cells is demonstrated in schistosomiasis. PMID: 21160045
  38. Data suggest that the CD23-mediated signal transduction pathways in human B cells and human monocytes are different. PMID: 20805040
  39. Data indicate that the regions of CD23 responsible for interaction with ligands have been identified and help to explain the structure-function relationships within the CD23 protein. PMID: 20831712
  40. CD23 is a useful marker in distinguishing mediastinal diffuse large B-cell lymphoma and classical Hodgkin lymphoma in mediastinal biopsies. PMID: 19223373
  41. Interaction of functional FCER2 promoter polymorphism and phenotype-associated haplotypes. PMID: 19845913
  42. cd23 negativity is rare in typical b-cell CLL; negativity in patients with CD19+/CD5+ is suggestive of mantle cell leukemia. PMID: 11920534
  43. Prognostic significance of soluble CD23 in advanced stages of B-chronic lymphocytic leukemia and its role as an indicator for aggressive or indolent courses of disease. PMID: 12002758
  44. A review on the domains and functions of the cd23 receptor. PMID: 12022472
  45. Upstream regions of the CD23a and CD23b isoform coding sequences show distinct sensitivities to agents which induce CD23 protein expression at the plasma membrane. PMID: 12070780
  46. Investigation of several stimulators to promote CD23a expression on CLL vs. normal B-cells confirmed a different CD23 regulation in B-CLL. CD23a is always predominantly expressed (constant ratio of CD23a:CD23b). PMID: 12127553
  47. CD23 expression in chronic lymphocytic leukemia was 53.9 times higher than in mantle-cell lymphoma. PMID: 12127555
  48. At term, the percentage of CD21(+) and CD23(+) B cells was comparable to adults. PMID: 12149502
  49. The promoter is a target for NF-AT transcription factors in B-CLL cells. PMID: 12379312
  50. The data show that monocyte-derived DC express the P2X7 receptor whose activation opens a cation-selective channel, and which leads to rapid and near complete shedding of CD23. PMID: 12456589

Show More

Hide All

Database Links

HGNC: 3612

OMIM: 151445

KEGG: hsa:2208

STRING: 9606.ENSP00000264072

UniGene: Hs.465778

Subcellular Location
Cell membrane; Single-pass type II membrane protein. Cell membrane; Lipid-anchor. Secreted. Note=Also exists as a soluble excreted form, sCD23.

Q&A

What is FCER2 and what is its primary function in human immunology?

FCER2, also known as CD23, functions as the low-affinity Fc receptor for IgE. When expressed on B cells, it plays a critical role in regulating IgE synthesis through a negative feedback mechanism . The protein is a type II integral membrane protein with a single transmembrane region, where the carboxy-terminal region is extracellular and the amino-terminal domain is intracytoplasmic . FCER2 has several additional designations including BLAST-2, C-type lectin domain family 4 member J, Fc-epsilon-RII, and Immunoglobulin E-binding factor .

Methodologically, researchers investigating FCER2 function typically employ:

  • Flow cytometry to assess expression levels on immune cells

  • Binding assays to measure IgE-FCER2 interactions

  • Gene expression analysis to quantify FCER2 regulation

  • Cell culture systems with B cell transfectants to study functional properties

How does FCER2 structurally interact with IgE molecules?

FCER2 interacts with IgE through its extracellular domain. Research has demonstrated that certain genetic variants of FCER2, such as the R62W polymorphism (rs2228137), can significantly alter IgE binding affinity. Experimental evidence shows that B cells expressing the CD23b-R62W variant bind IgE with greater affinity than wild-type cells . The binding affinity (Ka) values were calculated to be significantly higher for the variant form compared to wild-type .

For researchers investigating this interaction:

  • Surface plasmon resonance provides quantitative binding kinetics

  • Competitive binding assays can determine relative affinities

  • Structural biology approaches (X-ray crystallography, cryo-EM) reveal molecular interfaces

  • Site-directed mutagenesis helps identify critical binding residues

Which FCER2 polymorphisms are most strongly associated with asthma, and what are their functional consequences?

Multiple polymorphisms in the FCER2 gene have been associated with asthma susceptibility and phenotypes. The most extensively studied include:

SNP IDAmino Acid ChangeAssociated PhenotypesFunctional Impact
rs2228137R62WAsthma susceptibility, increased IgE levelsEnhanced IgE binding affinity, altered ERK1/2 activation
rs28364072-COPD and asthma riskAssociated with disease predisposition
rs12368672-Asthma susceptibilityDifferential distribution between asthma patients and controls

The rs2228137 polymorphism (R62W) is located in exon 4 of the FCER2 gene in the extracellular segment of the protein close to the transmembrane domain . This variation appears to confer significant functional changes, as B-cell transfectants expressing the R62W SNP show increased IL-4R expression after CD23 stimulation, which may facilitate signaling through IL-4 and favor class switching to increase IgE synthesis .

Research methodologies for investigating these associations include:

  • Case-control genetic association studies

  • Functional assays with cell lines expressing variant forms

  • Haplotype analysis to identify combinatorial genetic effects

  • Expression quantitative trait loci (eQTL) analysis

How do FCER2 polymorphisms influence response to asthma treatments?

FCER2 polymorphisms have been linked to differential responses to asthma treatments, particularly inhaled corticosteroids. Research has identified that certain FCER2 variants are associated with an increased risk of exacerbations in asthmatic children taking inhaled corticosteroids, despite the generally protective effects of this medication class .

In a significant study, children homozygous for a specific FCER2 variant showed substantially increased risk of exacerbations: hazard ratios were 3.95 (95% CI: 1.64–9.51) for Caucasian children and 3.08 (95% CI: 1.00–9.47) for African–American children . This variant was also associated with both differences in IgE levels and differential expression of the FCER2 gene, supporting the hypothesis that variation in FCER2 can adversely affect normal negative feedback mechanisms in IgE regulation .

Researchers investigating pharmacogenetic relationships should consider:

  • Prospective clinical trials stratified by FCER2 genotype

  • Biomarker studies correlating genotype with treatment response

  • In vitro assays examining corticosteroid response pathways in cells with different FCER2 variants

  • Systems biology approaches to understand pathway interactions

What expression systems are optimal for producing recombinant FCER2 for research purposes?

Production of recombinant FCER2 has been successfully accomplished using several expression systems, each with distinct advantages for different research applications:

Expression SystemAdvantagesLimitationsApplications
E. coliHigh yield, cost-effective, simple purificationLacks post-translational modificationsStructural studies, antibody production
Mammalian cellsNative-like glycosylation, proper foldingLower yield, higher costFunctional studies, binding assays
Insect cellsModerate glycosylation, high expressionNot identical to human PTMsCrystallography, binding studies

Commercial recombinant human FCER2 is available as a partial protein (expression region 48-248aa) with an N-terminal 6xHis-tag, commonly expressed in E. coli with a theoretical molecular weight of 27.3 kDa . For functional studies, researchers often develop stable human B-cell transfectants expressing wild-type or variant FCER2 .

Methodological considerations include:

  • Codon optimization for the chosen expression system

  • Inclusion of appropriate purification tags

  • Validation of proper folding and activity

  • Storage conditions to maintain stability

What techniques provide the most reliable assessment of FCER2 binding kinetics?

Several techniques yield quantitative insights into FCER2-IgE binding kinetics, each offering different advantages:

  • Surface Plasmon Resonance (SPR):

    • Provides real-time, label-free measurements

    • Determines association (kon) and dissociation (koff) rate constants

    • Calculates equilibrium dissociation constant (KD)

    • Requires relatively pure protein samples

  • Bio-Layer Interferometry (BLI):

    • Similar advantages to SPR but with different optical detection

    • More tolerant of crude samples

    • Easier to implement in high-throughput format

  • Isothermal Titration Calorimetry (ITC):

    • Measures thermodynamic parameters (ΔH, ΔS)

    • Does not require immobilization or labeling

    • Provides stoichiometry information

  • Flow Cytometry-Based Binding Assays:

    • Assesses binding on cell surface-expressed FCER2

    • Can be used with intact cells

    • Provides information about binding in a more physiological context

Research has employed these techniques to demonstrate that CD23b-R62W-expressing human B cells bind IgE with greater affinity than wild-type cells .

What evidence supports the role of FCER2 as a common genetic link between asthma and COPD?

Research increasingly supports the Dutch hypothesis proposing that asthma and COPD may share common genetic origins. FCER2 has emerged as one of the genes potentially linking these conditions:

  • Genetic association studies have identified FCER2 polymorphisms associated with both diseases:

    • The rs28364072 SNP shows significant differences between COPD patients and controls (P=0.009)

    • The rs2228137 variant is associated with asthma susceptibility (P=0.010)

  • Functional impacts relevant to both conditions:

    • FCER2 haplotypes were associated with pulmonary function measurements in both asthma and COPD patients

    • FCER2 variants correlate with blood eosinophil counts in both diseases

  • Potential therapeutic implications:

    • These findings suggest that anti-IgE biologics, currently used in asthma treatment, might benefit specific COPD subtypes

Research methodologies to investigate this connection include:

  • Comparative genetic studies in asthma and COPD cohorts

  • Functional characterization of shared genetic variants

  • Development of animal models expressing disease-associated variants

  • Transcriptomic and proteomic analyses of airway samples

How do FCER2 polymorphisms contribute to eosinophilic inflammation in respiratory diseases?

FCER2 polymorphisms appear to influence eosinophilic inflammation through several mechanisms:

  • Altered IgE regulation:

    • Certain FCER2 variants result in increased IgE binding affinity

    • This may disrupt the normal negative feedback control of IgE production

    • Elevated IgE levels can promote eosinophil recruitment and activation

  • Direct effects on inflammatory signaling:

    • FCER2 variants show differences in ERK1/2 activation kinetics

    • This alters downstream signaling cascades involved in inflammatory responses

    • Changes in Egr-1 mRNA levels have been observed after stimulation through variant CD23

  • Clinical correlations:

    • FCER2 haplotypes are associated with blood eosinophil counts in both asthma and COPD patients

    • These associations suggest a mechanistic link between genetic variation and cellular phenotype

Researchers investigating these relationships typically employ:

  • Flow cytometric assessment of eosinophil counts and activation markers

  • Cytokine profiling of patient samples

  • In vitro cell culture models with variant FCER2 expression

  • Transgenic animal models to study pathway effects in vivo

What are the methodological challenges in targeting FCER2 for therapeutic development?

Developing therapeutics targeting FCER2 presents several methodological challenges:

  • Structural complexity:

    • FCER2 exists in both membrane-bound and soluble forms

    • The protein undergoes post-translational modifications affecting function

    • Targeting specific domains without disrupting beneficial functions requires precision

  • Functional redundancy:

    • The immune system has multiple regulatory pathways for IgE

    • Complete inhibition may have unintended consequences for immune defense

    • Partial modulation may be insufficient for clinical benefit

  • Genetic heterogeneity:

    • Population variation in FCER2 polymorphisms affects treatment response

    • Personalized approaches may be needed based on genetic profiles

    • Clinical trials must account for genetic stratification

  • Technical challenges:

    • Developing high-specificity binding molecules

    • Ensuring adequate drug delivery to relevant tissues

    • Monitoring target engagement in vivo

Future research approaches should consider:

  • Structure-based drug design targeting specific FCER2 domains

  • Development of allele-specific therapeutics for variant forms

  • Combination approaches targeting multiple points in the IgE regulatory pathway

  • Biomarker strategies to identify patients most likely to benefit

How can systems biology approaches enhance our understanding of FCER2 in immune network regulation?

Systems biology offers powerful frameworks to understand FCER2's role within broader immune regulatory networks:

  • Multi-omics integration:

    • Combining genomic, transcriptomic, and proteomic data

    • Correlating FCER2 genetic variants with expression changes and protein interaction networks

    • Identifying key nodes and feedback loops in IgE regulation

  • Network modeling:

    • Constructing mathematical models of FCER2 signaling pathways

    • Simulating the effects of genetic variants on pathway dynamics

    • Predicting emergent behaviors in complex immune networks

  • Single-cell approaches:

    • Characterizing cell-specific FCER2 expression patterns

    • Identifying rare cell populations with unique FCER2 functions

    • Mapping cellular communication networks involving FCER2

  • Translational integration:

    • Correlating molecular findings with clinical phenotypes

    • Developing predictive models for treatment response

    • Designing rational combination therapies based on network analysis

These approaches collectively enable:

  • Identification of novel therapeutic targets connected to FCER2 pathways

  • Better prediction of treatment responses based on network states

  • More comprehensive understanding of how FCER2 variants affect global immune regulation

  • Integration of FCER2 research with broader immunological mechanisms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.